Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1155.43
PubTator Score 113.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.400 4.2e-04
atypical teratoid / rhabdoid tumor -1.100 1.9e-04
glioblastoma -1.200 1.8e-04
medulloblastoma, large-cell -1.300 7.8e-04
non primary Sjogren syndrome sicca 1.300 1.4e-02
osteosarcoma 1.267 7.2e-06
ovarian cancer -1.400 5.0e-07
psoriasis 1.200 2.9e-04
spina bifida 1.027 3.6e-02

Gene RIF (7)

AA Sequence

MAGTWLLLLLALGCPALPTGVGGTPFPSLAPPIMLLVDGKQQMVVVCLVLDVAPPGLDSPIWFSAGNGSA      1 - 70
LDAFTYGPSPATDGTWTNLAHLSLPSEELASWEPLVCHTGPGAEGHSRSTQPMHLSGEASTARTCPQEPL     71 - 140
RGTPGGALWLGVLRLLLFKLLLFDLLLTCSCLCDPAGPLPSPATTTRLRALGSHRLHPATETGGREATSS    141 - 210
PRPQPRDRRWGDTPPGRKPGSPVWGEGSYLSSYPTCPAQAWCSRSALRAPSSSLGAFFAGDLPPPLQAGA    211 - 280
A//

Text Mined References (16)

PMID Year Title