Property Summary

NCBI Gene PubMed Count 13
Grant Count 79
R01 Count 40
Funding $14,701,367.51
PubMed Score 1118.28
PubTator Score 113.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 3.200 0.000
osteosarcoma 1.267 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.300 0.001
adult high grade glioma -1.400 0.000
non primary Sjogren syndrome sicca 1.300 0.014
spina bifida 1.027 0.036
ovarian cancer -1.400 0.000

Synonym

Accession Q6ISU1 Q5TFZ7 pT-alpha
Symbols PTA
PT-ALPHA

Gene

PDB

3OF6  

Gene RIF (7)

PMID Text
19527514 Observational study of gene-disease association. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17823309 identified a polyproline-arginine sequence in the pTalpha cytoplasmic tail that interacted in vitro with SH3 domains of the CIN85/CMS family of adaptors, and mediated the recruitment of multiprotein complexes involving all (CMS, CIN85, and CD2BP3) members
14500629 High levels of pre-T cell receptor alpha-chain mRNA splice forms have been demonstrated in immature CD2+CD7+CD3- T cells of the jejunal mucosa, both intraepithelially and in lamina propria.
11891328 Combined expression of pTalpha and Notch3 in T cell leukemia identifies the requirement of preTCR for leukemogenesis
1979339 HIV-1 envelope glycoproteins gp120 and gp160 directly and specifically impair the CD3/TcR-mediated activation of phospholipase C (PLC) via the CD4 molecule in uninfected T cells

AA Sequence

MAGTWLLLLLALGCPALPTGVGGTPFPSLAPPIMLLVDGKQQMVVVCLVLDVAPPGLDSPIWFSAGNGSA      1 - 70
LDAFTYGPSPATDGTWTNLAHLSLPSEELASWEPLVCHTGPGAEGHSRSTQPMHLSGEASTARTCPQEPL     71 - 140
RGTPGGALWLGVLRLLLFKLLLFDLLLTCSCLCDPAGPLPSPATTTRLRALGSHRLHPATETGGREATSS    141 - 210
PRPQPRDRRWGDTPPGRKPGSPVWGEGSYLSSYPTCPAQAWCSRSALRAPSSSLGAFFAGDLPPPLQAGA    211 - 280
A//

Text Mined References (16)

PMID Year Title
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
22795130 2012 Ubiquitin-dependent intramembrane rhomboid protease promotes ERAD of membrane proteins.
20944746 2010 The structural basis for autonomous dimerization of the pre-T-cell antigen receptor.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
17823309 2007 Identification of CMS as a cytosolic adaptor of the human pTalpha chain involved in pre-TCR function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14500629 2003 Extrathymic TCR gene rearrangement in human small intestine: identification of new splice forms of recombination activating gene-1 mRNA with selective tissue expression.
More...