Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.58
PubTator Score 2.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma -2.100 0.000
posterior fossa group A ependymoma -3.100 0.000
glioblastoma -3.000 0.000
oligodendroglioma -2.400 0.000
group 4 medulloblastoma -1.900 0.006
medulloblastoma, large-cell -2.100 0.000
primitive neuroectodermal tumor -2.000 0.002
intraductal papillary-mucinous neoplasm ... -1.500 0.001
adult high grade glioma -3.100 0.000
atypical teratoid/rhabdoid tumor -1.100 0.015
pilocytic astrocytoma -2.600 0.000
pituitary cancer -1.800 0.001
psoriasis -1.400 0.000

Synonym

Accession Q6IS24 Q8NFV9 Q9NTA8
Symbols GALNT16
GALNT20
GALNTL3
GALNACT17
GalNAc-T5L

Gene

PANTHER Protein Class (2)

Gene RIF (3)

PMID Text
22787146 a subset of O-glycosylation produced by WBSCR17 controls dynamic membrane trafficking, probably between the cell surface and the late endosomes through macropinocytosis
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQDAVLKRLSLL      1 - 70
EDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGYNSYLSEKISLDRSIPDYRPT     71 - 140
KCKELKYSKDLPQISIIFIFVNEALSVILRSVHSAVNHTPTHLLKEIILVDDNSDEEELKVPLEEYVHKR    141 - 210
YPGLVKVVRNQKREGLIRARIEGWKVATGQVTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQ    211 - 280
DNFEVQRYENSAHGYSWELWCMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVY    281 - 350
GGENIELGIKVWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP    351 - 420
LENPGIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLDQGPLENHTAI    421 - 490
LYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLDCDKVKSSLYKRWNFIQNGAI    491 - 560
MNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNSIK                                    561 - 598
//

Text Mined References (15)

PMID Year Title
24939585 2015 Genome-wide association analysis demonstrates the highly polygenic character of age-related hearing impairment.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
22787146 2012 A putative polypeptide N-acetylgalactosaminyltransferase/Williams-Beuren syndrome chromosome region 17 (WBSCR17) regulates lamellipodium formation and macropinocytosis.
22566498 2012 Genomic association analysis identifies multiple loci influencing antihypertensive response to an angiotensin II receptor blocker.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15744064 2005 Cloning and expression of a brain-specific putative UDP-GalNAc: polypeptide N-acetylgalactosaminyltransferase gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...