Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.35
PubTator Score 2.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -3.100 3.6e-06
astrocytic glioma -1.600 1.3e-03
Astrocytoma, Pilocytic -2.600 1.9e-06
atypical teratoid/rhabdoid tumor -1.100 1.5e-02
ependymoma -1.300 2.2e-02
glioblastoma -3.000 1.7e-11
group 3 medulloblastoma -1.500 1.6e-02
intraductal papillary-mucinous neoplasm ... -1.500 1.3e-03
medulloblastoma, large-cell -2.100 4.1e-05
oligodendroglioma -2.400 6.4e-21
pituitary cancer -1.800 8.2e-04
primitive neuroectodermal tumor -2.000 2.2e-03
psoriasis -1.400 3.2e-37

Gene RIF (4)

AA Sequence

MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQDAVLKRLSLL      1 - 70
EDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGYNSYLSEKISLDRSIPDYRPT     71 - 140
KCKELKYSKDLPQISIIFIFVNEALSVILRSVHSAVNHTPTHLLKEIILVDDNSDEEELKVPLEEYVHKR    141 - 210
YPGLVKVVRNQKREGLIRARIEGWKVATGQVTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQ    211 - 280
DNFEVQRYENSAHGYSWELWCMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVY    281 - 350
GGENIELGIKVWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP    351 - 420
LENPGIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLDQGPLENHTAI    421 - 490
LYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLDCDKVKSSLYKRWNFIQNGAI    491 - 560
MNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNSIK                                    561 - 598
//

Text Mined References (16)

PMID Year Title