Property Summary

NCBI Gene PubMed Count 31
PubMed Score 19.52
PubTator Score 18.88

Knowledge Summary

Patent (2,710)

TINX Plot

  Disease (7)

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma 1.061 2.3e-04
adult high grade glioma -1.900 2.3e-08
Alzheimer's disease 1.400 4.7e-02
astrocytic glioma -1.300 3.1e-02
Astrocytoma, Pilocytic -1.200 1.6e-07
atypical teratoid / rhabdoid tumor -2.000 1.3e-09
Breast cancer -1.200 1.0e-08
colon cancer -1.200 2.3e-02
ependymoma -1.200 5.1e-03
glioblastoma -1.700 2.8e-12
group 3 medulloblastoma -1.100 1.5e-03
invasive ductal carcinoma -1.100 2.9e-03
medulloblastoma, large-cell -1.500 3.7e-05
non primary Sjogren syndrome sicca -1.100 2.2e-02
oligodendroglioma -1.100 2.1e-02
osteosarcoma -1.569 3.6e-07
ovarian cancer -2.400 5.0e-15
Pick disease 1.800 4.0e-05
progressive supranuclear palsy 1.700 2.1e-02
psoriasis -1.100 2.7e-09
Rheumatoid arthritis 2.000 4.0e-03

Gene RIF (18)

AA Sequence

MSGGGEQLDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKK      1 - 70
LQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGRQILESIESIHSVGFLHR     71 - 140
DIKPSNFAMGRFPSTCRKCYMLDFGLARQFTNSCGDVRPPRAVAGFRGTVRYASINAHRNREMGRHDDLW    141 - 210
SLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYDHRLMLKHLPPEFSIFLDHISSLDYFTKPDYQLLTSVF    211 - 280
DNSIKTFGVIESDPFDWEKTGNDGSLTTTTTSTTPQLHTRLTPAAIGIANATPIPGDLLRENTDEVFPDE    281 - 350
QLSDGENGIPVGVSPDKLPGSLGHPRPQEKDVWEEMDANKNKIKLGICKAATEEENSHGQANGLLNAPSL    351 - 420
GSPIRVRSEITQPDRDIPLVRKLRSIHSFELEKRLTLEPKPDTDKFLETCLEKMQKDTSAGKESILPALL    421 - 490
HKPCVPAVSRTDHIWHYDEEYLPDASKPASANTPEQADGGGSNGFIAVNLSSCKQEIDSKEWVIVDKEQD    491 - 560
LQDFRTNEAVGHKTTGSPSDEEPEVLQVLEASPQDEKLQLGPWAENDHLKKETSGVVLALSAEGPPTAAS    561 - 630
EQYTDRLELQPGAASQFIAATPTSLMEAQAEGPLTAITIPRPSVASTQSTSGSFHCGQQPEKKDLQPMEP    631 - 700
TVELYSPRENFSGLVVTEGEPPSGGSRTDLGLQIDHIGHDMLPNIRESNKSQDLGPKELPDHNRLVVREF    701 - 770
ENLPGETEEKSILLESDNEDEKLSRGQHCIEISSLPGDLVIVEKDHSATTEPLDVTKTQTFSVVPNQDKN    771 - 840
NEIMKLLTVGTSEISSRDIDPHVEGQIGQVAEMQKNKISKDDDIMSEDLPGHQGDLSTFLHQEGKREKIT    841 - 910
PRNGELFHCVSENEHGAPTRKDMVRSSFVTRHSRIPVLAQEIDSTLESSSPVSAKEKLLQKKAYQPDLVK    911 - 980
LLVEKRQFKSFLGDLSSASDKLLEEKLATVPAPFCEEEVLTPFSRLTVDSHLSRSAEDSFLSPIISQSRK    981 - 1050
SKIPRPVSWVNTDQVNSSTSSQFFPRPPPGKPPTRPGVEARLRRYKVLGSSNSDSDLFSRLAQILQNGSQ   1051 - 1120
KPRSTTQCKSPGSPHNPKTPPKSPVVPRRSPSASPRSSSLPRTSSSSPSRAGRPHHDQRSSSPHLGRSKS   1121 - 1190
PPSHSGSSSSRRSCQQEHCKPSKNGLKGSGSLHHHSASTKTPQGKSKPASKLSR                   1191 - 1244
//

Text Mined References (34)

PMID Year Title