Property Summary

NCBI Gene PubMed Count 29
Grant Count 8
Funding $1,064,257.67
PubMed Score 17.71
PubTator Score 18.88

Knowledge Summary

Patent (2,710)

Expression

  Differential Expression (21)

Disease log2 FC p
Rheumatoid Arthritis 2.000 0.004
astrocytic glioma -1.500 0.005
ependymoma -1.700 0.000
oligodendroglioma -1.100 0.021
glioblastoma -2.700 0.000
osteosarcoma -1.569 0.000
medulloblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -2.800 0.000
medulloblastoma, large-cell -2.800 0.000
adrenocortical carcinoma 1.061 0.000
colon cancer -1.200 0.023
adult high grade glioma -2.000 0.000
pilocytic astrocytoma -1.600 0.000
non primary Sjogren syndrome sicca -1.100 0.022
psoriasis -1.100 0.000
Alzheimer's disease 1.400 0.047
Pick disease 1.800 0.000
progressive supranuclear palsy 1.700 0.021
Breast cancer -1.200 0.000
invasive ductal carcinoma -1.100 0.003
ovarian cancer -2.400 0.000

Synonym

Accession Q6IQ55 O94932 Q6ZN52 Q8IVV1
Symbols TTBK
SCA11

Gene

  TechDev Info (1)

Jing-Ruey Yeh gRNA validated for zebrafish model, zebrafish mutant available

 Collection (1)

Gene RIF (16)

PMID Text
26323690 TTBK2 phosphorylates KIF2A and antagonizes KIF2A-induced depolymerization at microtubules plus ends for cell migration.
25950000 TTBK2 is a multifunctional kinase involved in important cellular processes and demands augmented efforts in investigating its functions
25473830 TTBK1/2 kinases may represent attractive targets for therapeutic intervention for TDP-43 proteinopathies such as Amyotrophic lateral sclerosis and Frontotemporal lobar degeneration-TDP.
25297623 TTBK2 bound EB1 and Cep164 through its SxIP motifs and a proline-rich motif, respectively.
24982133 data suggest that TTBK2 also acts upstream of Cep164, contributing to the assembly of distal appendages
23141541 Dominant truncating mutations in human TTBK2 cause spinocerebellar ataxia type 11 (SCA11); these mutant proteins do not promote ciliogenesis and inhibit ciliogenesis in wild-type cells.
22814243 TTBK2 is a completely novel regulator of Na(+)-coupled glucose transport.
22020623 findings reveals a major role of PRKX, TTBK2 and RSK4 in triggering Sunitinib resistance formation; data suggest transcriptional regulation of these kinases together with other proteins might play an important role in formation of Sunitinib resistance by affecting transcription factors
20667868 two-basepair deletion (c.1306_1307delGA, p.D435fs448X in exon 12) lead to a premature stop codon in the TTBK2 gene; spinocerebellar ataxia patients had phenotypic of slowly progressive almost pure cerebellar ataxia with normal life expectancy
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MSGGGEQLDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKK      1 - 70
LQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGRQILESIESIHSVGFLHR     71 - 140
DIKPSNFAMGRFPSTCRKCYMLDFGLARQFTNSCGDVRPPRAVAGFRGTVRYASINAHRNREMGRHDDLW    141 - 210
SLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYDHRLMLKHLPPEFSIFLDHISSLDYFTKPDYQLLTSVF    211 - 280
DNSIKTFGVIESDPFDWEKTGNDGSLTTTTTSTTPQLHTRLTPAAIGIANATPIPGDLLRENTDEVFPDE    281 - 350
QLSDGENGIPVGVSPDKLPGSLGHPRPQEKDVWEEMDANKNKIKLGICKAATEEENSHGQANGLLNAPSL    351 - 420
GSPIRVRSEITQPDRDIPLVRKLRSIHSFELEKRLTLEPKPDTDKFLETCLEKMQKDTSAGKESILPALL    421 - 490
HKPCVPAVSRTDHIWHYDEEYLPDASKPASANTPEQADGGGSNGFIAVNLSSCKQEIDSKEWVIVDKEQD    491 - 560
LQDFRTNEAVGHKTTGSPSDEEPEVLQVLEASPQDEKLQLGPWAENDHLKKETSGVVLALSAEGPPTAAS    561 - 630
EQYTDRLELQPGAASQFIAATPTSLMEAQAEGPLTAITIPRPSVASTQSTSGSFHCGQQPEKKDLQPMEP    631 - 700
TVELYSPRENFSGLVVTEGEPPSGGSRTDLGLQIDHIGHDMLPNIRESNKSQDLGPKELPDHNRLVVREF    701 - 770
ENLPGETEEKSILLESDNEDEKLSRGQHCIEISSLPGDLVIVEKDHSATTEPLDVTKTQTFSVVPNQDKN    771 - 840
NEIMKLLTVGTSEISSRDIDPHVEGQIGQVAEMQKNKISKDDDIMSEDLPGHQGDLSTFLHQEGKREKIT    841 - 910
PRNGELFHCVSENEHGAPTRKDMVRSSFVTRHSRIPVLAQEIDSTLESSSPVSAKEKLLQKKAYQPDLVK    911 - 980
LLVEKRQFKSFLGDLSSASDKLLEEKLATVPAPFCEEEVLTPFSRLTVDSHLSRSAEDSFLSPIISQSRK    981 - 1050
SKIPRPVSWVNTDQVNSSTSSQFFPRPPPGKPPTRPGVEARLRRYKVLGSSNSDSDLFSRLAQILQNGSQ   1051 - 1120
KPRSTTQCKSPGSPHNPKTPPKSPVVPRRSPSASPRSSSLPRTSSSSPSRAGRPHHDQRSSSPHLGRSKS   1121 - 1190
PPSHSGSSSSRRSCQQEHCKPSKNGLKGSGSLHHHSASTKTPQGKSKPASKLSR                   1191 - 1244
//

Text Mined References (32)

PMID Year Title
26323690 2015 TTBK2 with EB1/3 regulates microtubule dynamics in migrating cells through KIF2A phosphorylation.
26063658 2015 Heterozygous HTRA1 mutations are associated with autosomal dominant cerebral small vessel disease.
25950000 2015 TTBK2: a tau protein kinase beyond tau phosphorylation.
25473830 2014 The tau tubulin kinases TTBK1/2 promote accumulation of pathological TDP-43.
25416956 2014 A proteome-scale map of the human interactome network.
25297623 2014 Binding to Cep164, but not EB1, is essential for centriolar localization of TTBK2 and its function in ciliogenesis.
24982133 2014 Cep164 triggers ciliogenesis by recruiting Tau tubulin kinase 2 to the mother centriole.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23141541 2012 The spinocerebellar ataxia-associated gene Tau tubulin kinase 2 controls the initiation of ciliogenesis.
22863007 2012 Exome capture reveals ZNF423 and CEP164 mutations, linking renal ciliopathies to DNA damage response signaling.
More...