Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.71
PubTator Score 2.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Schizophrenia 1160
Disease Target Count P-value
ovarian cancer 8520 1.0e-07
malignant mesothelioma 3232 6.3e-06
Rheumatoid arthritis 1191 7.8e-03
spina bifida 1074 3.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count
Burn-Mckeown syndrome 3

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.100 6.3e-06
ovarian cancer -1.300 1.0e-07
Rheumatoid arthritis 1.300 7.8e-03
spina bifida -1.170 3.6e-02

Gene RIF (2)

AA Sequence

MFQIPVENLDNIRKVRKKVKGILVDIGLDSCKELLKDLKGFDPGEKYFHNTSWGDVSLWEPSGKKVRYRT      1 - 70
KPYCCGLCKYSTKVLTSFKNHLHRYHEDEIDQELVIPCPNCVFASQPKVVGRHFRMFHAPVRKVQNYTVN     71 - 140
ILGETKSSRSDVISFTCLKCNFSNTLYYSMKKHVLVAHFHYLINSYFGLRTEEMGEQPKTNDTVSIEKIP    141 - 210
PPDKYYCKKCNANASSQDALMYHILTSDIHRDLENKLRSVISEHIKRTGLLKQTHIAPKPAAHLAAPANG    211 - 280
SAPSAPAQPPCFHLALPQNSPSPAAGQPVTVAQGAPGSLTHSPPAAGQSHMTLVSSPLPVGQNSLTLQPP    281 - 350
APQPVFLSHGVPLHQSVNPPVLPLSQPVGPVNKSVGTSVLPINQTVRPGVLPLTQPVGPINRPVGPGVLP    351 - 420
VSPSVTPGVLQAVSPGVLSVSRAVPSGVLPAGQMTPAGQMTPAGVIPGQTATSGVLPTGQMVQSGVLPVG    421 - 490
QTAPSRVLPPGQTAPLRVISAGQVVPSGLLSPNQTVSSSAVVPVNQGVNSGVLQLSQPVVSGVLPVGQPV    491 - 560
RPGVLQLNQTVGTNILPVNQPVRPGASQNTTFLTSGSILRQLIPTGKQVNGIPTYTLAPVSVTLPVPPGG    561 - 630
LATVAPPQMPIQLLPSGAAAPMAGSMPGMPSPPVLVNAAQSVFVQASSSAADTNQVLKQAKQWKTCPVCN    631 - 700
ELFPSNVYQVHMEVAHKHSESKSGEKLEPEKLAACAPFLKWMREKTVRCLSCKCLVSEEELIHHLLMHGL    701 - 770
GCLFCPCTFHDIKGLSEHSRNRHLGKKKLPMDYSNRGFQLDVDANGNLLFPHLDFITILPKEKLGEREVY    771 - 840
LAILAGIHSKSLVPVYVKVRPQAEGTPGSTGKRVSTCPFCFGPFVTTEAYELHLKERHHIMPTVHTVLKS    841 - 910
PAFKCIHCCGVYTGNMTLAAIAVHLVRCRSAPKDSSSDLQAQPGFIHNSELLLVSGEVMHDSSFSVKRKL    911 - 980
PDGHLGAEDQRHGEEQPPILNADAAPGPEKVTSVVPFKRQRNESRTEGPIVKDEALQILALDPKKYEGRS    981 - 1050
YEEKKQFLKDYFHKKPYPSKKEIELLSSLFWVWKIDVASFFGKRRYICMKAIKNHKPSVLLGFDMSELKN   1051 - 1120
VKHRLNFEYEP                                                              1121 - 1131
//

Text Mined References (12)

PMID Year Title