Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.41
PubTator Score 2.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia 1.200 4.4e-02
atypical teratoid / rhabdoid tumor -1.100 1.8e-04
medulloblastoma, large-cell -2.100 1.8e-04
ovarian cancer -1.800 9.1e-06
primary pancreatic ductal adenocarcinoma 1.033 1.1e-02

Synonym

Accession Q6IQ16
Symbols BTBD33

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MSREPTPPLPGDMSTGPIAESWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSSGPSDKMKWCLR      1 - 70
VNPKGLDDESKDYLSLYLLLVSCPKSEVRAKFKFSLLNAKREETKAMESQRAYRFVQGKDWGFKKFIRRD     71 - 140
FLLDEANGLLPDDKLTLFCEVSVVQDSVNISGHTNTNTLKVPECRLAEDLGNLWENTRFTDCSFFVRGQE    141 - 210
FKAHKSVLAARSPVFNAMFEHEMEESKKNRVEINDLDPEVFKEMMRFIYTGRAPNLDKMADNLLAAADKY    211 - 280
ALERLKVMCEEALCSNLSVENVADTLVLADLHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNSNQATDI    281 - 350
METSGWKSMIQSHPHLVAEAFRALASAQCPQFGIPRKRLKQS                                351 - 392
//

Text Mined References (11)

PMID Year Title