Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.04
PubTator Score 2.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 9.12746366322775E-6
medulloblastoma, large-cell 6234 1.75793122888811E-4
atypical teratoid / rhabdoid tumor 4369 1.77563019730855E-4
primary pancreatic ductal adenocarcinoma 1271 0.011108587358741
acute myeloid leukemia 785 0.0440053247732224
Disease Target Count Z-score Confidence
Omphalocele 22 4.025 2.0

Expression

  Differential Expression (5)

Synonym

Accession Q6IQ16
Symbols BTBD33

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid

 MGI Term (1)

AA Sequence

MSREPTPPLPGDMSTGPIAESWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSSGPSDKMKWCLR      1 - 70
VNPKGLDDESKDYLSLYLLLVSCPKSEVRAKFKFSLLNAKREETKAMESQRAYRFVQGKDWGFKKFIRRD     71 - 140
FLLDEANGLLPDDKLTLFCEVSVVQDSVNISGHTNTNTLKVPECRLAEDLGNLWENTRFTDCSFFVRGQE    141 - 210
FKAHKSVLAARSPVFNAMFEHEMEESKKNRVEINDLDPEVFKEMMRFIYTGRAPNLDKMADNLLAAADKY    211 - 280
ALERLKVMCEEALCSNLSVENVADTLVLADLHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNSNQATDI    281 - 350
METSGWKSMIQSHPHLVAEAFRALASAQCPQFGIPRKRLKQS                                351 - 392
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23241943 2013 Genome-wide association study of patient-rated and clinician-rated global impression of severity during antipsychotic treatment.
22632832 2012 Adaptor protein self-assembly drives the control of a cullin-RING ubiquitin ligase.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16740475 2006 A hedgehog-induced BTB protein modulates hedgehog signaling by degrading Ci/Gli transcription factor.
16651542 2006 Roadkill attenuates Hedgehog responses through degradation of Cubitus interruptus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.