Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.05
PubTator Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 9.1e-06
fibroadenoma 559 2.6e-02

Expression

  Differential Expression (2)

Disease log2 FC p
fibroadenoma 1.200 2.6e-02
psoriasis -1.300 9.1e-06

AA Sequence

MEKPYNKNEGNLENEGKPEDEVEPDDEGKSDEEEKPDAEGKTECEGKRKAEGEPGDEGQLEDKGSQEKQG      1 - 70
KSEGEGKPQGEGKPASQAKPEGQPRAAEKRPAGDYVPRKAKRKTDRGTDDSPKDSQEDLQERHLSSEEMM     71 - 140
RECGDVSRAQEELRKKQKMGGFHWMQRDVQDPFAPRGQRGVRGVRGGGRGQRGLHDIPYL              141 - 200
//

Text Mined References (4)

PMID Year Title