Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.57

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6IPT4 B7ZBS4 Q8NF25
Symbols

Gene

PANTHER Protein Class (2)

AA Sequence

MMAEREEDDDTEEAWMQLRPTEPLPSQCCGSGCSPCVFDLYHRDLARWEAAQASKDRSLLRGPESQSCPS      1 - 70
KLNPETFVAFCIIAMDRLTKDTYRVRFALPGNSQLGLRPGQHLILRGIVDDLEIQRAYTPISPANAEGYF     71 - 140
EVLIKCYQMGLMSRYVESWRVGDTAFWRGPFGDFFYKPNQYGELLLLAAGTGLAPMVPILQSITDNENDE    141 - 210
TFVTLVGCFKTFESIYLKTFLQEQARFWNVRTFFVLSQESSSEQLPWSYQEKTHFGHLGQDLIKELVSCC    211 - 280
RRKPFALVCGSAEFTKDIARCLLCAGLTEDSYFLF                                       281 - 315
//

Text Mined References (4)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.