Property Summary

NCBI Gene PubMed Count 11
PubMed Score 7.58
PubTator Score 18.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute quadriplegic myopathy 1.540 1.6e-07
Alzheimer's disease -1.200 3.2e-02
Amyotrophic lateral sclerosis 1.307 7.6e-08
Breast cancer -2.600 3.3e-02
intraductal papillary-mucinous adenoma (... 1.200 4.5e-04
lung cancer 2.100 2.6e-05
malignant mesothelioma -2.800 1.2e-07
medulloblastoma, large-cell -1.700 1.7e-05
osteosarcoma -1.221 2.0e-03
ovarian cancer -1.900 8.6e-12
pancreatic ductal adenocarcinoma liver m... 1.767 3.3e-02
Pick disease -2.300 9.7e-07
progressive supranuclear palsy -1.700 7.2e-03

Gene RIF (4)

AA Sequence

MEVQVSQASLGFELTSVEKSLREWSRLSREVIAWLCPSSPNFILNFPPPPSASSVSMVQLFSSPFGYQSP      1 - 70
SGHSEEEREGNMKSAKPQVNHSQHGESQRALSPLQSTLSSAASPSQAYETYIENGLICLKHKIRNIEKKK     71 - 140
LKLEDYKDRLKSGEHLNPDQLEAVEKYEEVLHNLEFAKELQKTFSGLSLDLLKAQKKAQRREHMLKLEAE    141 - 210
KKKLRTILQVQYVLQNLTQEHVQKDFKGGLNGAVYLPSKELDYLIKFSKLTCPERNESLSVEDQMEQSSL    211 - 280
YFWDLLEGSEKAVVGTTYKHLKDLLSKLLNSGYFESIPVPKNAKEKEVPLEEEMLIQSEKKTQLSKTESV    281 - 350
KESESLMEFAQPEIQPQEFLNRRYMTEVDYSNKQGEEQPWEADYARKPNLPKRWDMLTEPDGQEKKQESF    351 - 420
KSWEASGKHQEVSKPAVSLEQRKQDTSKLRSTLPEEQKKQEISKSKPSPSQWKQDTPKSKAGYVQEEQKK    421 - 490
QETPKLWPVQLQKEQDPKKQTPKSWTPSMQSEQNTTKSWTTPMCEEQDSKQPETPKSWENNVESQKHSLT    491 - 560
SQSQISPKSWGVATASLIPNDQLLPRKLNTEPKDVPKPVHQPVGSSSTLPKDPVLRKEKLQDLMTQIQGT    561 - 630
CNFMQESVLDFDKPSSAIPTSQPPSATPGSPVASKEQNLSSQSDFLQEPLQATSSPVTCSSNACLVTTDQ    631 - 700
ASSGSETEFMTSETPEAAIPPGKQPSSLASPNPPMAKGSEQGFQSPPASSSSVTINTAPFQAMQTVFNVN    701 - 770
APLPPRKEQEIKESPYSPGYNQSFTTASTQTPPQCQLPSIHVEQTVHSQETAANYHPDGTIQVSNGSLAF    771 - 840
YPAQTNVFPRPTQPFVNSRGSVRGCTRGGRLITNSYRSPGGYKGFDTYRGLPSISNGNYSQLQFQAREYS    841 - 910
GAPYSQRDNFQQCYKRGGTSGGPRANSRAGWSDSSQVSSPERDNETFNSGDSGQGDSRSMTPVDVPVTNP    911 - 980
AATILPVHVYPLPQQMRVAFSAARTSNLAPGTLDQPIVFDLLLNNLGETFDLQLGRFNCPVNGTYVFIFH    981 - 1050
MLKLAVNVPLYVNLMKNEEVLVSAYANDGAPDHETASNHAILQLFQGDQIWLRLHRGAIYGSSWKYSTFS   1051 - 1120
GYLLYQD                                                                  1121 - 1127
//

Text Mined References (15)

PMID Year Title