Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.09
PubTator Score 12.88

Knowledge Summary

Patent (105)

AA Sequence

MANITRMANHTGKLDFILMGLFRRSKHPALLSVVIFVVFLKALSGNAVLILLIHCDAHLHSPMYFFISQL      1 - 70
SLMDMAYISVTVPKMLLDQVMGVNKVSAPECGMQMFLYLTLAGSEFFLLATMAYDRYVAICHPLRYPVLM     71 - 140
NHRVCLFLASGCWFLGSVDGFMLTPITMSFPFCRSWEIHHFFCEVPAVTILSCSDTSLYETLMYLCCVLM    141 - 210
LLIPVTIISSSYLLILLTVHRMNSAEGRKKAFATCSSHLTVVILFYGAAVYTYMLPSSYHTPEKDMMVSV    211 - 280
FYTILTPVLNPLIYSLRNKDVMGALKKMLTVRFVL                                       281 - 315
//

Text Mined References (3)

PMID Year Title