Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.27
PubTator Score 254.59

Knowledge Summary

Patent (2,226)

AA Sequence

MDGENHSVVSEFLFLGLTHSWEIQLLLLVFSSVLYVASITGNILIVFSVTTDPHLHSPMYFLLASLSFID      1 - 70
LGACSVTSPKMIYDLFRKRKVISFGGCIAQIFFIHVVGGVEMVLLIAMAFDRYVALCKPLHYLTIMSPRM     71 - 140
CLSFLAVAWTLGVSHSLFQLAFLVNLAFCGPNVLDSFYCDLPRLLRLACTDTYRLQFMVTVNSGFICVGT    141 - 210
FFILLISYVFILFTVWKHSSGGSSKALSTLSAHSTVVLLFFGPPMFVYTRPHPNSQMDKFLAIFDAVLTP    211 - 280
FLNPVVYTFRNKEMKAAIKRVCKQLVIYKRIS                                          281 - 312
//

Text Mined References (3)

PMID Year Title