Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.13
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... 1.005 9.8e-03
osteosarcoma -3.507 2.9e-09
subependymal giant cell astrocytoma 1.715 1.4e-02

Gene RIF (1)

AA Sequence

MCIIFFKFDPRPVSKNAYRLILAANRDEFYSRPSKLADFWGNNNEILSGLDMEEGKEGGTWLGISTRGKL      1 - 70
AALTNYLQPQLDWQARGRGELVTHFLTTDVDSLSYLKKVSMEGHLYNGFNLIAADLSTAKGDVICYYGNR     71 - 140
GEPDPIVLTPGTYGLSNALLETPWRKLCFGKQLFLEAVERSQALPKDVLIASLLDVLNNEEAQLPDPAIE    141 - 210
DQGGEYVQPMLSKYAAVCVRCPGYGTRTNTIILVDADGHVTFTERSMMDKDLSHWETRTYEFTLQS        211 - 276
//

Text Mined References (13)

PMID Year Title