Property Summary

NCBI Gene PubMed Count 8
Grant Count 19
R01 Count 15
Funding $2,588,360.57
PubMed Score 5.33
PubTator Score 2.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (5)

PMID Text
23388340 The expression of GRAMD4 is up-regulated in hepatocellular carcinoma cell(HCC cell) lines and HCC tissues, and the increased expression is correlated with the clinicopathological characteristics of HCC.
21127500 GRAMD4 induces changes in Bcl-2 and Bax protein levels
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15565177 localizes to the mitochondria, upregulated following E2F1 induction
15565177 DIP induces p53-independent caspase-dependent and -independent apoptosis. DIP is localized in the mitochondria. DIP accumulates upon E2F1 activation.

AA Sequence

MLRRLDKIRFRGHKRDDFLDLAESPNASDTECSDEIPLKVPRTSPRDSEELRDPAGPGTLIMATGVQDFN      1 - 70
RTEFDRLNEIKGHLEIALLEKHFLQEELRKLREETNAEMLRQELDRERQRRMELEQKVQEVLKARTEEQM     71 - 140
AQQPPKGQAQASNGAERRSQGLSSRLQKWFYERFGEYVEDFRFQPEENTVETEEPLSARRLTENMRRLKR    141 - 210
GAKPVTNFVKNLSALSDWYSVYTSAIAFTVYMNAVWHGWAIPLFLFLAILRLSLNYLIARGWRIQWSIVP    211 - 280
EVSEPVEPPKEDLTVSEKFQLVLDVAQKAQNLFGKMADILEKIKNLFMWVQPEITQKLYVALWAAFLASC    281 - 350
FFPYRLVGLAVGLYAGIKFFLIDFIFKRCPRLRAKYDTPYIIWRSLPTDPQLKERSSAAVSRRLQTTSSR    351 - 420
SYVPSAPAGLGKEEDAGRFHSTKKGNFHEIFNLTENERPLAVCENGWRCCLINRDRKMPTDYIRNGVLYV    421 - 490
TENYLCFESSKSGSSKRNKVIKLVDITDIQKYKVLSVLPGSGMGIAVSTPSTQKPLVFGAMVHRDEAFET    491 - 560
ILSQYIKITSAAASGGDS                                                        561 - 578
//

Text Mined References (13)

PMID Year Title
23388340 2013 [Expression and clinicopathological significance of GRAMD4 in hepatocellular carcinoma].
21127500 2011 GRAMD4 mimics p53 and mediates the apoptotic function of p73 at mitochondria.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18302964 2008 Molecular profiling of genes in squamous cell lung carcinoma in Asian Indians.
16225677 2005 Systematic mutation analysis of KIAA0767 and KIAA1646 in chromosome 22q-linked periodic catatonia.
15565177 2005 A novel mitochondrial protein DIP mediates E2F1-induced apoptosis independently of p53.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...