Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.33
PubTator Score 2.96

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
adrenocortical carcinoma -1.415 2.0e-09
intraductal papillary-mucinous carcinoma... 1.200 1.2e-03
malignant mesothelioma 1.500 7.6e-07
osteosarcoma -1.332 5.9e-03
ovarian cancer 1.100 2.1e-05
posterior fossa group B ependymoma 1.100 4.7e-08

Gene RIF (5)

AA Sequence

MLRRLDKIRFRGHKRDDFLDLAESPNASDTECSDEIPLKVPRTSPRDSEELRDPAGPGTLIMATGVQDFN      1 - 70
RTEFDRLNEIKGHLEIALLEKHFLQEELRKLREETNAEMLRQELDRERQRRMELEQKVQEVLKARTEEQM     71 - 140
AQQPPKGQAQASNGAERRSQGLSSRLQKWFYERFGEYVEDFRFQPEENTVETEEPLSARRLTENMRRLKR    141 - 210
GAKPVTNFVKNLSALSDWYSVYTSAIAFTVYMNAVWHGWAIPLFLFLAILRLSLNYLIARGWRIQWSIVP    211 - 280
EVSEPVEPPKEDLTVSEKFQLVLDVAQKAQNLFGKMADILEKIKNLFMWVQPEITQKLYVALWAAFLASC    281 - 350
FFPYRLVGLAVGLYAGIKFFLIDFIFKRCPRLRAKYDTPYIIWRSLPTDPQLKERSSAAVSRRLQTTSSR    351 - 420
SYVPSAPAGLGKEEDAGRFHSTKKGNFHEIFNLTENERPLAVCENGWRCCLINRDRKMPTDYIRNGVLYV    421 - 490
TENYLCFESSKSGSSKRNKVIKLVDITDIQKYKVLSVLPGSGMGIAVSTPSTQKPLVFGAMVHRDEAFET    491 - 560
ILSQYIKITSAAASGGDS                                                        561 - 578
//

Text Mined References (13)

PMID Year Title