Property Summary

NCBI Gene PubMed Count 2
PubMed Score 2.08
PubTator Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Azoospermia 89 3.657 1.8

Synonym

Accession Q6GV28
Symbols PMP22CD
PPP1R154

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid

AA Sequence

MVHVSNRSIQGMNILFSSWAVVLMVMGITLDKWVELISEDERAKMNHSPWMMCCPALWPEDDLKVVRIMM      1 - 70
TSSLGLSFLLNLILGMKFTYLIPQNKYIQLFTTILSFFSGISLLWALILYHNKLKQGQSMHFSNYRITWI     71 - 140
MYTAYLNVFFLSVCGVLSLLECKLSTSSCTCLNIHKSDNECKESENSIEDISLPECTAMPRSIVRAHTVN    141 - 210
SLNKKVQTRHVTWAL                                                           211 - 225
//

Text Mined References (2)

PMID Year Title
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.