Property Summary

NCBI Gene PubMed Count 2
PubMed Score 2.08
PubTator Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Azoospermia 89 3.657 1.8

Synonym

Accession Q6GV28
Symbols PMP22CD
PPP1R154

Gene

AA Sequence

MVHVSNRSIQGMNILFSSWAVVLMVMGITLDKWVELISEDERAKMNHSPWMMCCPALWPEDDLKVVRIMM      1 - 70
TSSLGLSFLLNLILGMKFTYLIPQNKYIQLFTTILSFFSGISLLWALILYHNKLKQGQSMHFSNYRITWI     71 - 140
MYTAYLNVFFLSVCGVLSLLECKLSTSSCTCLNIHKSDNECKESENSIEDISLPECTAMPRSIVRAHTVN    141 - 210
SLNKKVQTRHVTWAL                                                           211 - 225
//

Text Mined References (2)

PMID Year Title
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.