Property Summary

NCBI Gene PubMed Count 3
PubMed Score 4.03
PubTator Score 2.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 7.43628633567414E-6

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.100 0.000

Synonym

Accession Q6GMV2 D6W5H3 Q13558
Symbols RRG1
RAI15
NN8-4AG
ZMYND23

Gene

  Ortholog (11)

 IMPC Term (1)

AA Sequence

MAASMCDVFSFCVGVAGRARVSVEVRFVSSAKGKGLFATQLIRKGETIFVERPLVAAQFLWNALYRYRAC      1 - 70
DHCLRALEKAEENAQRLTGKPGQVLPHPELCTVRKDLHQNCPHCQVMYCSAECRLAATEQYHQVLCPGPS     71 - 140
QDDPLHPLNKLQEAWRSIHYPPETASIMLMARMVATVKQAKDKDRWIRLFSQFCNKTANEEEEIVHKLLG    141 - 210
DKFKGQLELLRRLFTEALYEEAVSQWFTPDGFRSLFALVGTNGQGIGTSSLSQWVHACDTLELKPQDREQ    211 - 280
LDAFIDQLYKDIEAATGEFLNCEGSGLFVLQSCCNHSCVPNAETSFPENNFLLHVTALEDIKPGEEICIS    281 - 350
YLDCCQRERSRHSRHKILRENYLFVCSCPKCLAEADEPNVTSEEEEEEEEEEEGEPEDAELGDEMTDV      351 - 418
//

Text Mined References (4)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8754834 1996 Isolation of a novel retinoic acid-responsive gene by selection of genomic fragments derived from CpG-island-enriched DNA.