Property Summary

NCBI Gene PubMed Count 7
PubMed Score 52.52
PubTator Score 12.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 4.3e-18
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Lymph node tuberculosis 3 4.036 2.0
Wolman disease 6 3.553 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -3.000 4.3e-18

Gene RIF (2)

AA Sequence

MLLPSKKDLKTALDVFAVFQWSFSALLITTTVIAVNLYLVVFTPYWPVTVLILTWLAFDWKTPQRGGRRF      1 - 70
TCVRHWRLWKHYSDYFPLKLLKTHDICPSRNYILVCHPHGLFAHGWFGHFATEASGFSKIFPGITPYILT     71 - 140
LGAFFWMPFLREYVMSTGACSVSRSSIDFLLTHKGTGNMVIVVIGGLAECRYSLPGSSTLVLKNRSGFVR    141 - 210
MALQHGVPLIPAYAFGETDLYDQHIFTPGGFVNRFQKWFQSMVHIYPCAFYGRGFTKNSWGLLPYSRPVT    211 - 280
TIVGEPLPMPKIENPSQEIVAKYHTLYIDALRKLFDQHKTKFGISETQELEII                     281 - 333
//

Text Mined References (7)

PMID Year Title