Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.39
PubTator Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
acute quadriplegic myopathy 1158 1.6e-07
ovarian cancer 8520 9.4e-04

Expression

  Differential Expression (2)

Disease log2 FC p
acute quadriplegic myopathy 1.100 1.6e-07
ovarian cancer -1.100 9.4e-04

 MGI Phenotype (1)

AA Sequence

MAEQEQRKIPLVPENLLKKRKAYQALKATQAKQALLAKKEQKKGKGLRFKRLESFLHDSWRQKRDKVRLR      1 - 70
RLEVKPHALELPDKHSLAFVVRIERIDGVSLLVQRTIARLRLKKIFSGVFVKVTPQNLKMLRIVEPYVTW     71 - 140
GFPNLKSVRELILKRGQAKVKNKTIPLTDNTVIEEHLGKFGVICLEDLIHEIAFPGKHFQEISWFLCPFH    141 - 210
LSVARHATKNRVGFLKEMGTPGYRGERINQLIRQLN                                      211 - 246
//

Text Mined References (10)

PMID Year Title