Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.39
PubTator Score 0.13

Knowledge Summary


No data available


  Disease Relevance (2)


  Differential Expression (2)

Disease log2 FC p
acute quadriplegic myopathy 1.100 0.000
ovarian cancer -1.100 0.001


Accession Q6DKI1 A8K7D4 B7Z652 Q5TFZ5 Q6PEK3
Symbols dJ475N16.4


AA Sequence

LSVARHATKNRVGFLKEMGTPGYRGERINQLIRQLN                                      211 - 246

Text Mined References (10)

PMID Year Title
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.