Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.34
PubTator Score 33.96

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
Atopic dermatitis -1.100 7.5e-05
atypical teratoid / rhabdoid tumor 1.500 3.3e-03
group 3 medulloblastoma 1.800 7.1e-05
intraductal papillary-mucinous carcinoma... 2.400 5.5e-03
medulloblastoma, large-cell 2.500 3.5e-02
psoriasis -1.200 2.6e-25

Gene RIF (1)

AA Sequence

MAAVAVLRNDSLQAFLQDRTPSASPDLGKHSPLALLAATCSRIGQPGAAAPPDFLQVPYDPALGSPSRLF      1 - 70
HPWTADMPAHSPGALPPPHPSLGLTPQKTHLQPSFGAAHELPLTPPADPSYPYEFSPVKMLPSSMAALPA     71 - 140
SCAPAYVPYAAQAALPPGYSNLLPPPPPPPPPPTCRQLSPNPAPDDLPWWSIPQAGAGPGASGVPGSGLS    141 - 210
GACAGAPHAPRFPASAAAAAAAAAALQRGLVLGPSDFAQYQSQIAALLQTKAPLAATARRCRRCRCPNCQ    211 - 280
AAGGAPEAEPGKKKQHVCHVPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKSFTRSDELQRHLRTH    281 - 350
TGEKRFACPECGKRFMRSDHLAKHVKTHQNKKLKVAEAGVKREDARDL                          351 - 398
//

Text Mined References (4)

PMID Year Title