Property Summary

NCBI Gene PubMed Count 4
Grant Count 1
Funding $91,451.43
PubMed Score 0.34
PubTator Score 33.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
medulloblastoma 2.300 0.005
atypical teratoid / rhabdoid tumor 1.500 0.003
medulloblastoma, large-cell 2.500 0.035
Atopic dermatitis -1.100 0.000
intraductal papillary-mucinous carcinoma... 2.400 0.005
psoriasis -1.200 0.000

Gene RIF (1)

PMID Text
16380080 human Sp5 is a member of Sp transcription factor family with a role in human cancers

AA Sequence

MAAVAVLRNDSLQAFLQDRTPSASPDLGKHSPLALLAATCSRIGQPGAAAPPDFLQVPYDPALGSPSRLF      1 - 70
HPWTADMPAHSPGALPPPHPSLGLTPQKTHLQPSFGAAHELPLTPPADPSYPYEFSPVKMLPSSMAALPA     71 - 140
SCAPAYVPYAAQAALPPGYSNLLPPPPPPPPPPTCRQLSPNPAPDDLPWWSIPQAGAGPGASGVPGSGLS    141 - 210
GACAGAPHAPRFPASAAAAAAAAAALQRGLVLGPSDFAQYQSQIAALLQTKAPLAATARRCRRCRCPNCQ    211 - 280
AAGGAPEAEPGKKKQHVCHVPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKSFTRSDELQRHLRTH    281 - 350
TGEKRFACPECGKRFMRSDHLAKHVKTHQNKKLKVAEAGVKREDARDL                          351 - 398
//

Text Mined References (4)

PMID Year Title
16380080 2006 Elevated expression and potential roles of human Sp5, a member of Sp transcription factor family, in human cancers.
15820306 2005 Mammalian SP/KLF transcription factors: bring in the family.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.