Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.34
PubTator Score 33.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Prostatic Neoplasms 471
Disease Target Count P-value
psoriasis 6685 2.60596694912736E-25
Atopic dermatitis 944 7.5408056413149E-5
atypical teratoid / rhabdoid tumor 4369 0.00330889966743072
medulloblastoma 1524 0.00462534776115892
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00548333424083852
medulloblastoma, large-cell 6234 0.0349267034778517

Expression

  Differential Expression (6)

Disease log2 FC p
medulloblastoma 2.300 0.005
atypical teratoid / rhabdoid tumor 1.500 0.003
medulloblastoma, large-cell 2.500 0.035
Atopic dermatitis -1.100 0.000
intraductal papillary-mucinous carcinoma... 2.400 0.005
psoriasis -1.200 0.000

Synonym

Accession Q6BEB4
Symbols

Gene

SP5

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

Gene RIF (1)

PMID Text
16380080 human Sp5 is a member of Sp transcription factor family with a role in human cancers

AA Sequence

MAAVAVLRNDSLQAFLQDRTPSASPDLGKHSPLALLAATCSRIGQPGAAAPPDFLQVPYDPALGSPSRLF      1 - 70
HPWTADMPAHSPGALPPPHPSLGLTPQKTHLQPSFGAAHELPLTPPADPSYPYEFSPVKMLPSSMAALPA     71 - 140
SCAPAYVPYAAQAALPPGYSNLLPPPPPPPPPPTCRQLSPNPAPDDLPWWSIPQAGAGPGASGVPGSGLS    141 - 210
GACAGAPHAPRFPASAAAAAAAAAALQRGLVLGPSDFAQYQSQIAALLQTKAPLAATARRCRRCRCPNCQ    211 - 280
AAGGAPEAEPGKKKQHVCHVPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKSFTRSDELQRHLRTH    281 - 350
TGEKRFACPECGKRFMRSDHLAKHVKTHQNKKLKVAEAGVKREDARDL                          351 - 398
//

Text Mined References (4)

PMID Year Title
16380080 2006 Elevated expression and potential roles of human Sp5, a member of Sp transcription factor family, in human cancers.
15820306 2005 Mammalian SP/KLF transcription factors: bring in the family.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.