Property Summary

NCBI Gene PubMed Count 15
PubMed Score 22.41
PubTator Score 11.83

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 1.18177125985763E-8
medulloblastoma, large-cell 6234 6.0530478450323E-4


  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 3.700 0.000
medulloblastoma, large-cell 1.100 0.001


Accession Q6B0I6 B3KPC4 Q0VF39 Q9NT41 Q9NW76
Symbols JMJD2D



3DXT   3DXU   4D6Q   4D6R   4D6S   4HON   4HOO   5F5A   5F5C   5FP4   5FP8   5FP9   5FPA   5FPB  

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (6)

25714495 KDM4D-RNA interaction is required for KDM4D accumulation at DNA breakage sites
24550317 PARP1-dependent recruitment of KDM4D histone demethylase to DNA damage sites promotes double-strand break repair.
23219879 The molecular basis for JMJD2 site specificity revealed by X-ray crystallography.
22514644 Results demonstrate that JMJD2D can stimulate cell proliferation and survival, suggesting that its inhibition may be helpful in the fight against cancer
18187620 Knockdown of lysine (K)-specific demethylase 4D (KDM4D) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17555712 identified two related histone demethylases, JMJD2A and JMJD2D

AA Sequence

LPEDGALMDKPVPLSPGLQHPVKASGCSWAPVP                                         491 - 523

Text Mined References (17)

PMID Year Title
25714495 2015 The emerging role of lysine demethylases in DNA damage response: dissecting the recruitment mode of KDM4D/JMJD2D to DNA damage sites.
25124442 2014 Transdifferentiation. Sequential histone-modifying activities determine the robustness of transdifferentiation.
24550317 2014 PARP1-dependent recruitment of KDM4D histone demethylase to DNA damage sites promotes double-strand break repair.
23219879 2013 Structural and functional analysis of JMJD2D reveals molecular basis for site-specific demethylation among JMJD2 demethylases.
23102699 2012 Poly (ADP-ribose) glycohydrolase regulates retinoic acid receptor-mediated gene expression.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22514644 2012 Regulation of tumor suppressor p53 and HCT116 cell physiology by histone demethylase JMJD2D/KDM4D.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17555712 2007 Activation of androgen receptor by histone demethylases JMJD2A and JMJD2D.