Property Summary

Ligand Count 11
NCBI Gene PubMed Count 18
PubMed Score 28.33
PubTator Score 11.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 1.2e-08
medulloblastoma, large-cell 6241 6.1e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 3.700 1.2e-08
medulloblastoma, large-cell 1.100 6.1e-04

Synonym

Accession Q6B0I6 B3KPC4 Q0VF39 Q9NT41 Q9NW76
Symbols JMJD2D

Gene

PDB

3DXT   3DXU   4D6Q   4D6R   4D6S   4HON   4HOO   5F5A   5F5C   5FP4   5FP7   5FP8   5FP9   5FPA   5FPB   5PH0   5PH1   5PH2   5PH3   5PH4   5PH5   5PH6   5PH7   5PH8   5PH9   5PHA   5PHB   5PHC   5PHD   5PHE   5PHF   5PHG   5PHH   5PHI   5PHJ   5PHK   5PHL   5PHM   5PHN   5PHO   5PHP   5PHQ   5PHR   5PHS   5PHT   5PHU   5PHV   5PHW   5PHX   5PHY   5PHZ   5PI0   5PI1   5PI2   5PI3   5PI4   5PI5   5PI6   5PI7   5PI8   5PI9   5PIA   5PIB   5PIC   5PID   5PIE   5PIF   5PIG   5PIH   5PII   5PIJ   5PIK   5PIL   5PIM   5PIN   5PIO   5PIP   5PIQ   5PIR   5PIS   5PIT   5PIU   5PIV   5PIW   5PIX   5PIY   5PIZ   5PJ0   5PJ1   5PJ2   5PJ3   5PJ4   5PJ5   5PJ6   5PJ7   5PJ8   5PJ9   5PJA   5PJB   5PJC   5PJD   5PJE   5PJF   5PJG   5PJH   5PJI   5PJJ   5PJK   5PJL   5PJM   5PJN   5PJO   5PJP   5PJQ   5PJR   5PJS   5PJT   5PJU   5PJV   5PJW   5PJX   5PJY   5PJZ   5PK0   5PK1   5PK2   5PK3   5PK4   5PK5   5PK6   5PK7   5PK8   5PK9   5PKA   5PKB   5PKC   5PKD   5PKE   5PKF   5PKG   5PKH   5PKI   5PKJ   5PKK   5PKL   5PKM   5PKN   5PKO   5PKP   5PKQ   5PKR   5PKS   5PKT   5PKU   5PKV   5PKW   5PKX   5PKY   5PKZ   5PL0   5PL1   5PL2   5PL3   5PL4   5PL5   5PL6   5PL7   5PL8   5PL9   5PLA   5PLB   5PLC   5PLD   5PLE   5PLF   5PLG   5PLH   5PLI   5PLJ   5PLK   5PLL   5PLM   5PLN   5PLO   5PLP   5PLQ   5PLR   5PLS   5PLT   5PLU   5PLV   5PLW   5PLX   5PLY   5PLZ   5PM0   5PM1   5PM2   5PM3   5PM4   5PM5   5PM6   5PM7   5PM8   5PM9   5PMA   5PMB   5PMC   5PMD   5PME   5PMF   5PMG   5PMH   5PMI   5PMJ   5PMK   5PML   5PMM   5PMN   5PMO   5PMP   5PMQ   5PMR   5PMS   5PMT   5PMU   5PMV   5PMW   5PMX   5PMY   5PMZ   5PN0   5PN1   5PN2   5PN3   5PN4   5PN5   5PN6   5PN7   5PN8   5PN9   5PNA   5PNB   5PNC   5PND   5PNE   5PNF   5PNG   5PNH   5PNI   5PNJ   5PNK   5PNL   5PNM   5PNN   5PNO   5PNP   5PNQ   5PNR   5PNS   5PNU   5PNV   5PNW  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

AA Sequence

METMKSKANCAQNPNCNIMIFHPTKEEFNDFDKYIAYMESQGAHRAGLAKIIPPKEWKARETYDNISEIL      1 - 70
IATPLQQVASGRAGVFTQYHKKKKAMTVGEYRHLANSKKYQTPPHQNFEDLERKYWKNRIYNSPIYGADI     71 - 140
SGSLFDENTKQWNLGHLGTIQDLLEKECGVVIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHLGEPK    141 - 210
TWYVVPPEHGQRLERLARELFPGSSRGCGAFLRHKVALISPTVLKENGIPFNRITQEAGEFMVTFPYGYH    211 - 280
AGFNHGFNCAEAINFATPRWIDYGKMASQCSCGEARVTFSMDAFVRILQPERYDLWKRGQDRAVVDHMEP    281 - 350
RVPASQELSTQKEVQLPRRAALGLRQLPSHWARHSPWPMAARSGTRCHTLVCSSLPRRSAVSGTATQPRA    351 - 420
AAVHSSKKPSSTPSSTPGPSAQIIHPSNGRRGRGRPPQKLRAQELTLQTPAKRPLLAGTTCTASGPEPEP    421 - 490
LPEDGALMDKPVPLSPGLQHPVKASGCSWAPVP                                         491 - 523
//

Text Mined References (21)

PMID Year Title