Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.26
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6B0B8
Symbols

Gene

  Ortholog (9)

Gene RIF (1)

PMID Text
22080934 The strongest candidate as CENP-B paralogue, TIGD3, demonstrated no native centromeric binding when using raised antibodies, either in human cells or in cenpb (-/-) mouse ES cells.

AA Sequence

MELSSKKKLHALSLAEKIQVLELLDESKMSQSEVARRFQVSQPQISRICKNKEKLLADWCSGTANRERKR      1 - 70
KRESKYSGIDEALLCWYHIARAKAWDVTGPMLLHKAKELADIMGQDFVPSIGWLVRWKRRNNVGFGARHV     71 - 140
LAPSFPPEPPPPGLTSQAQLPLSLKDFSPEDVFGCAELPLLYRAVPGSFGACDQVQVLLCANSRGTEKRR    141 - 210
VLLGGLQAAPRCFFGIRSEALPASYHPDLGIPWLEWLAQFDRDMGQQGRQVALLLAARVVEELAGLPGLY    211 - 280
HVKLLPLAASSTTPPLPSSVVRAFKAHYRHRLLGKLAAIQSERDGTSLAEAGAGITVLDALHVASAAWAK    281 - 350
VPPQLIFSSFIQEGLAPGKTPPSSHKTSEMPPVPGGLSLEEFSRFVDLEGEEPRSGVCKEEIGTEDEKGD    351 - 420
REGAFEPLPTKADALRALGTLRRWFECNSTSPELFEKFYDCEEEVERLCCL                       421 - 471
//

Text Mined References (5)

PMID Year Title
22080934 2012 Putative CENP-B paralogues are not present at mammalian centromeres.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9253601 1997 A transcript map for the 2.8-Mb region containing the multiple endocrine neoplasia type 1 locus.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.