Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.26
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6B0B8
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (1)

AA Sequence

MELSSKKKLHALSLAEKIQVLELLDESKMSQSEVARRFQVSQPQISRICKNKEKLLADWCSGTANRERKR      1 - 70
KRESKYSGIDEALLCWYHIARAKAWDVTGPMLLHKAKELADIMGQDFVPSIGWLVRWKRRNNVGFGARHV     71 - 140
LAPSFPPEPPPPGLTSQAQLPLSLKDFSPEDVFGCAELPLLYRAVPGSFGACDQVQVLLCANSRGTEKRR    141 - 210
VLLGGLQAAPRCFFGIRSEALPASYHPDLGIPWLEWLAQFDRDMGQQGRQVALLLAARVVEELAGLPGLY    211 - 280
HVKLLPLAASSTTPPLPSSVVRAFKAHYRHRLLGKLAAIQSERDGTSLAEAGAGITVLDALHVASAAWAK    281 - 350
VPPQLIFSSFIQEGLAPGKTPPSSHKTSEMPPVPGGLSLEEFSRFVDLEGEEPRSGVCKEEIGTEDEKGD    351 - 420
REGAFEPLPTKADALRALGTLRRWFECNSTSPELFEKFYDCEEEVERLCCL                       421 - 471
//

Text Mined References (5)

PMID Year Title