Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.26
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
22080934 The strongest candidate as CENP-B paralogue, TIGD3, demonstrated no native centromeric binding when using raised antibodies, either in human cells or in cenpb (-/-) mouse ES cells.

AA Sequence

MELSSKKKLHALSLAEKIQVLELLDESKMSQSEVARRFQVSQPQISRICKNKEKLLADWCSGTANRERKR      1 - 70
KRESKYSGIDEALLCWYHIARAKAWDVTGPMLLHKAKELADIMGQDFVPSIGWLVRWKRRNNVGFGARHV     71 - 140
LAPSFPPEPPPPGLTSQAQLPLSLKDFSPEDVFGCAELPLLYRAVPGSFGACDQVQVLLCANSRGTEKRR    141 - 210
VLLGGLQAAPRCFFGIRSEALPASYHPDLGIPWLEWLAQFDRDMGQQGRQVALLLAARVVEELAGLPGLY    211 - 280
HVKLLPLAASSTTPPLPSSVVRAFKAHYRHRLLGKLAAIQSERDGTSLAEAGAGITVLDALHVASAAWAK    281 - 350
VPPQLIFSSFIQEGLAPGKTPPSSHKTSEMPPVPGGLSLEEFSRFVDLEGEEPRSGVCKEEIGTEDEKGD    351 - 420
REGAFEPLPTKADALRALGTLRRWFECNSTSPELFEKFYDCEEEVERLCCL                       421 - 471
//

Text Mined References (5)

PMID Year Title
22080934 2012 Putative CENP-B paralogues are not present at mammalian centromeres.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9253601 1997 A transcript map for the 2.8-Mb region containing the multiple endocrine neoplasia type 1 locus.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.