Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.15
PubTator Score 6.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.096 0.000
group 3 medulloblastoma 1.100 0.000

Gene RIF (5)

PMID Text
25725584 MiR-24 acted as an oncomir, at least partially through regulation of its functional target NAIF1 in non-small cell lung cancer.
25432142 NAIF1 plays a role in regulating cellular migration and invasion through the MAPK pathways and may function as a tumor suppressor in the progression of gastric carcinoma.
21286669 NAIF1 is down-regulated in gastric cancer.
18339812 The functions of two transposon-derived human proteins: HARBI1, a domesticated transposase-derived protein, and NAIF1, which contains a trihelix motif similar to that described in the Myb-like protein, was investigated.
16378748 NAIF1 (C9orf90)is a nuclear protein that induces apoptosis when overexpressed

AA Sequence

MAVPAKKRKMNFSEREVEIIVEELELKKHLLVNHFNAGVPLAAKSAAWHGILRRVNAVATCRRELPEVKK      1 - 70
KWSDLKTEVRRKVAQVRAAVEGGEAPGPTEEDGAGGPGTGGGSGGGGPAVAPVLLTPMQQRICNLLGEAT     71 - 140
IISLPSTTEIHPVALGPSATAAAATVTLTQIPTETTYHTLEEGVVEYCTAEAPPPLPPETPVDMMAQHAD    141 - 210
TSVKPQALKSRIALNSAKLIQEQRVTNLHVKEIAQHLEQQNDLLQMIRRSQEVQACAQERQAQAMEGTQA    211 - 280
ALSVLIQVLRPMIKDFRRYLQSNTANPAPASDPGQVAQNGQPDSIIQ                           281 - 327
//

Text Mined References (14)

PMID Year Title
25725584 2015 Upregulation of miR-24 promotes cell proliferation by targeting NAIF1 in non-small cell lung cancer.
25432142 2015 NAIF1 inhibits gastric cancer cells migration and invasion via the MAPK pathways.
25416956 2014 A proteome-scale map of the human interactome network.
21286669 2011 NAIF1 is down-regulated in gastric cancer and promotes apoptosis through the caspase-9 pathway in human MKN45 cells.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
18339812 2008 Transposition of a reconstructed Harbinger element in human cells and functional homology with two transposon-derived cellular genes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16378748 2006 Overexpression of the novel human gene, nuclear apoptosis-inducing factor 1, induces apoptosis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...