Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.15
PubTator Score 6.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 4.4e-05
group 3 medulloblastoma 4104 3.0e-04

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.100 3.0e-04
osteosarcoma -1.096 4.4e-05

Synonym

Accession Q69YI7 B3KV81 Q8WU12
Symbols C9orf90
bA379C10.2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

Gene RIF (5)

AA Sequence

MAVPAKKRKMNFSEREVEIIVEELELKKHLLVNHFNAGVPLAAKSAAWHGILRRVNAVATCRRELPEVKK      1 - 70
KWSDLKTEVRRKVAQVRAAVEGGEAPGPTEEDGAGGPGTGGGSGGGGPAVAPVLLTPMQQRICNLLGEAT     71 - 140
IISLPSTTEIHPVALGPSATAAAATVTLTQIPTETTYHTLEEGVVEYCTAEAPPPLPPETPVDMMAQHAD    141 - 210
TSVKPQALKSRIALNSAKLIQEQRVTNLHVKEIAQHLEQQNDLLQMIRRSQEVQACAQERQAQAMEGTQA    211 - 280
ALSVLIQVLRPMIKDFRRYLQSNTANPAPASDPGQVAQNGQPDSIIQ                           281 - 327
//

Text Mined References (14)

PMID Year Title