Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.30
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.600 3.9e-02
astrocytic glioma -1.400 4.6e-03
Astrocytoma, Pilocytic -1.600 8.7e-03
atypical teratoid / rhabdoid tumor -2.500 3.5e-06
ependymoma -1.500 5.9e-03
glioblastoma -1.900 2.2e-05
group 4 medulloblastoma -3.400 1.8e-03
medulloblastoma, large-cell -2.300 1.1e-02
oligodendroglioma -1.400 1.8e-02
primitive neuroectodermal tumor -2.200 5.4e-03
psoriasis -2.300 1.1e-33

Gene RIF (1)

AA Sequence

MALSGNCSRYYPREQGSAVPNSFPEVVELNVGGQVYFTRHSTLISIPHSLLWKMFSPKRDTANDLAKDSK      1 - 70
GRFFIDRDGFLFRYILDYLRDRQVVLPDHFPEKGRLKREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFE     71 - 140
DASQGSDTRICPPSSLLPADRKWGFITVGYRGSCTLGREGQADAKFRRVPRILVCGRISLAKEVFGETLN    141 - 210
ESRDPDRAPERYTSRFYLKFKHLERAFDMLSECGFHMVACNSSVTASFINQYTDDKIWSSYTEYVFYREP    211 - 280
SRWSPSHCDCCCKNGKGDKEGESGTSCNDLSTSSCDSQSEASSPQETVICGPVTRQTNIQTLDRPIKKGP    281 - 350
VQLIQQSEMRRKSDLLRTLTSGSRESNMSSKKKAVKEKLSIEEELEKCIQDFLKIKIPDRFPERKHPWQS    351 - 420
ELLRKYHL                                                                  421 - 428
//

Text Mined References (8)

PMID Year Title