Property Summary

NCBI Gene PubMed Count 11
Grant Count 13
R01 Count 13
Funding $952,973.5
PubMed Score 0.15
PubTator Score 6.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.189 0.001
acute quadriplegic myopathy 1.329 0.000
tuberculosis 1.100 0.000
diabetes mellitus -1.200 0.001
subependymal giant cell astrocytoma -1.362 0.005
Pick disease -1.200 0.001
ovarian cancer 1.900 0.000

Gene RIF (4)

PMID Text
24913909 Studies identi fi ed a novel signal of nuclear localization (NLS) in all MSL1 protein isoforms and found that the combination of both NLS allows for its intra-nuclear focal accumulation and nuclear transport of TTC4 while all MSL1 isoforms affect H4K16Ac.
24205110 The MSL1 bound to Nupr1, with a moderate affinity (2.8 microM) in an entropically-driven process. MSL1 did not bind to non-damaged DNA, but it bound to chemically-damaged-DNA with a moderate affinity (1.2 microM) also in an entropically-driven process.
19650074 MSL1 plays an important role in mediating irradiation-induced DNA repair through formation of HAT complexes and interaction with 53BP1. P8 acts as a negative regulator of this process by interacting with MSL1 and preventing its role on HAT activity.
16227571 A multisubunit human histone acetylase complex that contains homologs of the Drosophila MSL proteins MOF, MSL1 (hampin A), MSL2, and MSL3 was described. This complex is responsible for histone H4 lysine-16 acetylation of all cellular chromosomes.

AA Sequence

MTMRSAVFKAAAAPAGGNPEQRLDYERAAALGGPEDEPGAAEAHFLPRHRKLKEPGPPLASSQGGSPAPS      1 - 70
PAGCGGKGRGLLLPAGAAPGQQEESWGGSVPLPCPPPATKQAGIGGEPAAAGAGCSPRPKYQAVLPIQTG     71 - 140
SLVAAAKEPTPWAGDKGGAASPAATASDPAGPPPLPLPGPPPLAPTATAGTLAASEGRWKSMRKSPLGGG    141 - 210
GGSGASSQAACLKQILLLQLDLIEQQQQQLQAKEKEIEELKSERDTLLARIERMERRMQLVKKDNEKERH    211 - 280
KLFQGYETEEREETELSEKIKLECQPELSETSQTLPPKPFSCGRSGKGHKRKSPFGSTERKTPVKKLAPE    281 - 350
FSKVKTKTPKHSPIKEEPCGSLSETVCKRELRSQETPEKPRSSVDTPPRLSTPQKGPSTHPKEKAFSSEI    351 - 420
EDLPYLSTTEMYLCRWHQPPPSPLPLRESSPKKEETVARCLMPSSVAGETSVLAVPSWRDHSVEPLRDPN    421 - 490
PSDLLENLDDSVFSKRHAKLELDEKRRKRWDIQRIREQRILQRLQLRMYKKKGIQESEPEVTSFFPEPDD    491 - 560
VESLMITPFLPVVAFGRPLPKLTPQNFELPWLDERSRCRLEIQKKQTPHRTCRK                    561 - 614
//

Text Mined References (24)

PMID Year Title
24913909 2014 Two distinct nuclear localization signals in mammalian MSL1 regulate its function.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24205110 2013 Deciphering the binding between Nupr1 and MSL1 and their DNA-repairing activity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23084835 2012 Msl1-mediated dimerization of the dosage compensation complex is essential for male X-chromosome regulation in Drosophila.
22547026 2012 Structural insight into the regulation of MOF in the male-specific lethal complex and the non-specific lethal complex.
21726816 2011 The RING finger protein MSL2 in the MOF complex is an E3 ubiquitin ligase for H2B K34 and is involved in crosstalk with H3 K4 and K79 methylation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21217699 2011 Structural basis for MOF and MSL3 recruitment into the dosage compensation complex by MSL1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...