Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.15
PubTator Score 6.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.329 7.1e-06
diabetes mellitus -1.200 1.4e-03
Multiple myeloma 1.189 6.4e-04
ovarian cancer -1.600 5.6e-08
Pick disease -1.200 1.2e-03
subependymal giant cell astrocytoma -1.362 5.2e-03
tuberculosis 1.100 1.2e-05

Gene RIF (4)

AA Sequence

MTMRSAVFKAAAAPAGGNPEQRLDYERAAALGGPEDEPGAAEAHFLPRHRKLKEPGPPLASSQGGSPAPS      1 - 70
PAGCGGKGRGLLLPAGAAPGQQEESWGGSVPLPCPPPATKQAGIGGEPAAAGAGCSPRPKYQAVLPIQTG     71 - 140
SLVAAAKEPTPWAGDKGGAASPAATASDPAGPPPLPLPGPPPLAPTATAGTLAASEGRWKSMRKSPLGGG    141 - 210
GGSGASSQAACLKQILLLQLDLIEQQQQQLQAKEKEIEELKSERDTLLARIERMERRMQLVKKDNEKERH    211 - 280
KLFQGYETEEREETELSEKIKLECQPELSETSQTLPPKPFSCGRSGKGHKRKSPFGSTERKTPVKKLAPE    281 - 350
FSKVKTKTPKHSPIKEEPCGSLSETVCKRELRSQETPEKPRSSVDTPPRLSTPQKGPSTHPKEKAFSSEI    351 - 420
EDLPYLSTTEMYLCRWHQPPPSPLPLRESSPKKEETVARCLMPSSVAGETSVLAVPSWRDHSVEPLRDPN    421 - 490
PSDLLENLDDSVFSKRHAKLELDEKRRKRWDIQRIREQRILQRLQLRMYKKKGIQESEPEVTSFFPEPDD    491 - 560
VESLMITPFLPVVAFGRPLPKLTPQNFELPWLDERSRCRLEIQKKQTPHRTCRK                    561 - 614
//

Text Mined References (25)

PMID Year Title