Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.69
PubTator Score 0.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer 5.100 2.2e-02
glioblastoma 1.100 3.9e-03
group 3 medulloblastoma 1.400 1.2e-03
intraductal papillary-mucinous carcinoma... -1.100 2.3e-02
lung adenocarcinoma -1.500 2.8e-10
lung cancer -1.600 4.8e-04
lung carcinoma -1.400 1.9e-09
non-small cell lung cancer -1.542 2.6e-12
pediatric high grade glioma 1.300 2.7e-03
posterior fossa group A ependymoma 1.100 3.4e-04

Synonym

Accession Q68D86 A1A4H1 Q7Z467 Q8NDK7 Q9H5C1
Symbols AN
ACY1L
HsT1731
C18orf14

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MNLDSIHRLIEETQIFQMQQSSIKSRGDMVAPASPPRDTCNTCFPLHGLQSHAAHNFCAHSYNTNKWDIC      1 - 70
EELRLRELEEVKARAAQMEKTMRWWSDCTANWREKWSKVRAERNSAREEGRQLRIKLEMAMKELSTLKKK     71 - 140
QSLPPQKEALEAKVTQDLKLPGFVEESCEHTDQFQLSSQMHESIREYLVKRQFSTKEDTNNKEQGVVIDS    141 - 210
LKLSEEMKPNLDGVDLFNNGGSGNGETKTGLRLKAINLPLENEVTEISALQVHLDEFQKILWKEREMRTA    211 - 280
LEKEIERLESALSLWKWKYEELKESKPKNVKEFDILLGQHNDEMQELSGNIKEESKSQNSKDRVICELRA    281 - 350
ELERLQAENTSEWDKREILEREKQGLERENRRLKIQVKEMEELLDKKNRLSANSQSPDFKMSQIDLQEKN    351 - 420
QELLNLQHAYYKLNRQYQANIAELTHANNRVDQNEAEVKKLRLRVEELKQGLNQKEDELDDSLNQIRKLQ    421 - 490
RSLDEEKERNENLETELRHLQNW                                                   491 - 513
//

Text Mined References (11)

PMID Year Title