Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.96
PubTator Score 1.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.100 0.000
posterior fossa group B ependymoma 1.400 0.000
lung cancer 1.400 0.015
active Crohn's disease 1.129 0.009
atypical teratoid/rhabdoid tumor 1.100 0.000
ovarian cancer 3.500 0.000

Synonym

Accession Q68CQ7 Q7Z4D1 Q8N2J6 Q9P0I5
Symbols AD-017
MSTP139

Gene

Gene RIF (7)

PMID Text
25939412 rs6976 may contribute to hip osteoarthritis susceptibility by altering proximal femur shape.
24373612 Study showed the association of a polymorphism (rs2535629) of ITIH3 with psychiatric disorders in an Asian population and that rs2535629 influences the susceptibility to psychiatric disorders by affecting the expression level of GLT8D1
22461910 GLT8D1 was found to be differentially methylated and differentially expressed in human squamous cell carcinomas.
8218172 Addition of peripheral sugar residues such as galactose, N-acetylglucosamine, and sialic acid to HIV-1 gp120 is processed by specific glycosyltransferase
2649653 Addition of peripheral sugar residues such as galactose, N-acetylglucosamine, and sialic acid to HIV-1 gp120 is processed by specific glycosyltransferase
2341393 Addition of peripheral sugar residues such as galactose, N-acetylglucosamine, and sialic acid to HIV-1 gp120 is processed by specific glycosyltransferase
2283726 Addition of peripheral sugar residues such as galactose, N-acetylglucosamine, and sialic acid to HIV-1 gp120 is processed by specific glycosyltransferase

AA Sequence

MSFRKVNIIILVLAVALFLLVLHHNFLSLSSLLRNEVTDSGIVGPQPIDFVPNALRHAVDGRQEEIPVVI      1 - 70
AASEDRLGGAIAAINSIQHNTRSNVIFYIVTLNNTADHLRSWLNSDSLKSIRYKIVNFDPKLLEGKVKED     71 - 140
PDQGESMKPLTFARFYLPILVPSAKKAIYMDDDVIVQGDILALYNTALKPGHAAAFSEDCDSASTKVVIR    141 - 210
GAGNQYNYIGYLDYKKERIRKLSMKASTCSFNPGVFVANLTEWKRQNITNQLEKWMKLNVEEGLYSRTLA    211 - 280
GSITTPPLLIVFYQQHSTIDPMWNVRHLGSSAGKRYSPQFVKAAKLLHWNGHLKPWGRTASYTDVWEKWY    281 - 350
IPDPTGKFNLIRRYTEISNIK                                                     351 - 371
//

Text Mined References (19)

PMID Year Title
25939412 2015 Investigation of association between hip osteoarthritis susceptibility loci and radiographic proximal femur shape.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24373612 2014 ITIH3 polymorphism may confer susceptibility to psychiatric disorders by altering the expression levels of GLT8D1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
22763110 2012 Identification of new susceptibility loci for osteoarthritis (arcOGEN): a genome-wide association study.
22461910 2012 FOXM1 induces a global methylation signature that mimics the cancer epigenome in head and neck squamous cell carcinoma.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
19946888 2010 Defining the membrane proteome of NK cells.
More...