Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.04
PubTator Score 1.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
ependymoma 4679 5.1e-11
atypical teratoid/rhabdoid tumor 357 1.9e-06
psoriasis 6694 2.7e-06
ovarian cancer 8519 1.2e-05
active Crohn's disease 922 9.1e-03
lung cancer 4740 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Mood disorder 14 0.0 2.4

Expression

  Differential Expression (6)

Disease log2 FC p
active Crohn's disease 1.129 9.1e-03
atypical teratoid/rhabdoid tumor 1.100 1.9e-06
ependymoma 1.200 5.1e-11
lung cancer 1.400 1.5e-02
ovarian cancer -1.100 1.2e-05
psoriasis -1.100 2.7e-06

Gene RIF (7)

AA Sequence

MSFRKVNIIILVLAVALFLLVLHHNFLSLSSLLRNEVTDSGIVGPQPIDFVPNALRHAVDGRQEEIPVVI      1 - 70
AASEDRLGGAIAAINSIQHNTRSNVIFYIVTLNNTADHLRSWLNSDSLKSIRYKIVNFDPKLLEGKVKED     71 - 140
PDQGESMKPLTFARFYLPILVPSAKKAIYMDDDVIVQGDILALYNTALKPGHAAAFSEDCDSASTKVVIR    141 - 210
GAGNQYNYIGYLDYKKERIRKLSMKASTCSFNPGVFVANLTEWKRQNITNQLEKWMKLNVEEGLYSRTLA    211 - 280
GSITTPPLLIVFYQQHSTIDPMWNVRHLGSSAGKRYSPQFVKAAKLLHWNGHLKPWGRTASYTDVWEKWY    281 - 350
IPDPTGKFNLIRRYTEISNIK                                                     351 - 371
//

Text Mined References (19)

PMID Year Title