Property Summary

NCBI Gene PubMed Count 9
PubMed Score 24.29
PubTator Score 145.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
non-small cell lung cancer 2798 1.22353392095211E-19
hepatocellular carcinoma 550 3.64928220612419E-5
group 3 medulloblastoma 2254 2.64148467842741E-4
pancreatic carcinoma 567 0.00236304376357473
pancreatic cancer 2300 0.00236304376357474
ovarian cancer 8492 0.00348254525744791
lung cancer 4473 0.0106531723628199
Breast cancer 3099 0.0237535027308865
colon cancer 1475 0.0268631285529714
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Orofacial cleft 38 0.0 2.0
Disease Target Count Z-score Confidence
Tietze's syndrome 2 5.137 2.6
Cleft Lip 91 3.189 1.6
Cleft palate 125 3.044 1.5

Expression

  Differential Expression (9)

Disease log2 FC p
hepatocellular carcinoma 1.200 0.000
pancreatic cancer 1.100 0.002
non-small cell lung cancer 1.180 0.000
colon cancer 1.700 0.027
lung cancer 1.700 0.011
Breast cancer 4.000 0.024
group 3 medulloblastoma 1.400 0.000
pancreatic carcinoma 1.100 0.002
ovarian cancer 1.400 0.003

Synonym

Accession Q68CQ4 O75992 Q4VY00 Q63HL9
Symbols DEF
UTP25
C1orf107
DJ434O14.5

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
25007945 Colonic tissue from patients with Hirschsprung's disease showed lower expression levels of digestive-organ expansion factor (DIEXF).
16322560 characterization of the related zebrafish protein

AA Sequence

MGKRGSRSQSQLLNTLTKKQKKHLRDFGEEHPFYDRVSRKEAKPQICQLSESSDSSDSESDSESEPQQVS      1 - 70
GYHRLLATLKNVSEEEEEDEEEEEEEDSIVDDAEMNDEDGGSDVSVEEEMAAESTESPENVALSADPEGK     71 - 140
EDGEEPPGTSQTSPEEFTDAKHESLFSLETNFLEEESGDNSSLKASQDPFLQHVNKELKEKAIQAVATNP    141 - 210
KTTHELKWPILGQLFFSSKFQKLETFKPPKDIDLKSLHLQKPLESTWTKTNSQFLSGPQKSSSPFTPLQK    211 - 280
ELFLIMNSYRDLFYPERTALKNGEEIRHVYCLHVINHILKANAQVLGNNSRRRSQKFGVGDDDDFRDQGL    281 - 350
TRPKVLIVVPFREAALRVVQLFISLLEGDSKKKIIVSNKKRFQGEYGSDPEERPPNLKRPEDYEAVFVGN    351 - 420
IDDHFRIGVAILQRSIRLYAPFYSSDILIASPLGLRTIIGGEGEKKRDFDFLSSIELLIIDQADIYLMQN    421 - 490
WEHVLHLMNHMNLLPLDSHGVDFSRVRMWSLNNWSKYYRQTLLFGALQDAQINSVFNKYCVNMQGQVAVR    491 - 560
NVPMTGSISHVLVQLPHVFQRMEAENLASVIDARFNFFVNKILPQYRDAVMSHTLIYIPSYFDFVRLRNY    561 - 630
FKKEELNFTHICEYTQKSGVSRARHFFLQGEKQFLLFTERFHFYKRYTIKGIRNLIFYELPTYPHFYSEI    631 - 700
CNMLRATNRGEEATWTCTVLYSKYDAQRLAAVVGVERAAQMLQSNKNVHLFITGEK                  701 - 756
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25007945 2014 MiR-195 affects cell migration and cell proliferation by down-regulating DIEXF in Hirschsprung's disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22002106 2012 Systematic analysis of protein pools, isoforms, and modifications affecting turnover and subcellular localization.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...