Property Summary

NCBI Gene PubMed Count 11
PubMed Score 25.96
PubTator Score 145.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer 4.000 2.4e-02
colon cancer 1.700 2.7e-02
group 3 medulloblastoma 1.400 2.6e-04
hepatocellular carcinoma 1.100 2.0e-05
lung cancer 1.700 1.1e-02
non-small cell lung cancer 1.154 2.1e-23
ovarian cancer 1.400 3.5e-03
pancreatic cancer 1.100 2.4e-03
pancreatic carcinoma 1.100 2.4e-03

Protein-protein Interaction (3)

Gene RIF (3)

AA Sequence

MGKRGSRSQSQLLNTLTKKQKKHLRDFGEEHPFYDRVSRKEAKPQICQLSESSDSSDSESDSESEPQQVS      1 - 70
GYHRLLATLKNVSEEEEEDEEEEEEEDSIVDDAEMNDEDGGSDVSVEEEMAAESTESPENVALSADPEGK     71 - 140
EDGEEPPGTSQTSPEEFTDAKHESLFSLETNFLEEESGDNSSLKASQDPFLQHVNKELKEKAIQAVATNP    141 - 210
KTTHELKWPILGQLFFSSKFQKLETFKPPKDIDLKSLHLQKPLESTWTKTNSQFLSGPQKSSSPFTPLQK    211 - 280
ELFLIMNSYRDLFYPERTALKNGEEIRHVYCLHVINHILKANAQVLGNNSRRRSQKFGVGDDDDFRDQGL    281 - 350
TRPKVLIVVPFREAALRVVQLFISLLEGDSKKKIIVSNKKRFQGEYGSDPEERPPNLKRPEDYEAVFVGN    351 - 420
IDDHFRIGVAILQRSIRLYAPFYSSDILIASPLGLRTIIGGEGEKKRDFDFLSSIELLIIDQADIYLMQN    421 - 490
WEHVLHLMNHMNLLPLDSHGVDFSRVRMWSLNNWSKYYRQTLLFGALQDAQINSVFNKYCVNMQGQVAVR    491 - 560
NVPMTGSISHVLVQLPHVFQRMEAENLASVIDARFNFFVNKILPQYRDAVMSHTLIYIPSYFDFVRLRNY    561 - 630
FKKEELNFTHICEYTQKSGVSRARHFFLQGEKQFLLFTERFHFYKRYTIKGIRNLIFYELPTYPHFYSEI    631 - 700
CNMLRATNRGEEATWTCTVLYSKYDAQRLAAVVGVERAAQMLQSNKNVHLFITGEK                  701 - 756
//

Text Mined References (16)

PMID Year Title