Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.09
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
autosomal dominant Emery-Dreifuss muscul... 1.003 2.9e-02
Becker muscular dystrophy 1.236 7.4e-04
Breast cancer 1.100 2.3e-05
cystic fibrosis -3.240 1.8e-07
diabetes mellitus -1.300 2.9e-02
Duchenne muscular dystrophy 1.767 4.8e-10
gastric carcinoma 2.100 4.5e-02
glioblastoma multiforme 1.100 7.9e-07
head and neck cancer -1.100 4.4e-02
interstitial cystitis 1.700 1.6e-04
invasive ductal carcinoma 1.740 8.1e-03
juvenile dermatomyositis 1.161 3.7e-08
limb girdle muscular dystrophy 2A 1.061 3.2e-04
osteosarcoma 2.219 1.2e-02
ovarian cancer 1.200 1.4e-02
pancreatic cancer 1.100 2.2e-02
primary pancreatic ductal adenocarcinoma 3.137 3.0e-04
ulcerative colitis 1.100 2.0e-02

Gene RIF (3)

AA Sequence

MAKPRLLVLYFALIVVPAWVSSIVLTGTSEPPDAQTVAPAEDETLQNEADNQENVLSQLLGDYDKVKAMS      1 - 70
EGSDCQCKCVVRPLGRDACQRINAGASRKEDFYTVETITSGSSCKCACVAPPSALNPCEGDFRLQKLREA     71 - 140
DSQDLKLSTIIDMLEGAFYGLDLLKLHSVTTKLVGRVDKLEEEVSKNLTKENEQIKEDMEEIRTEMNKRG    141 - 210
KENCSENILDSMPDIRSALQRDAAAAYAHPEYEERFLQEETVSQQINSIELLQTRPLALPEVVKSQRPLQ    211 - 280
RQVHLRGRPASQPTVIRGITYYKAKVSEEENDIEEQQDEFFSGDNGVDLLIEDQLLRHNGLMTSVTRRPA    281 - 350
ATRQGHSTAVTSDLNARTAPWSSALPQPSTSDPSIANHASVGPTLQTTSVSPDPTRESVLQPSPQVPATT    351 - 420
VAHTATQQPAAPAPPAVSPREALMEAMHTVPVPPTTVRTDSLGKDAPAGWGTTPASPTLSPEEEDDIRNV    421 - 490
IGRCKDTLSTITGPTTQNTYGRNEGAWMKDPLAKDERIYVTNYYYGNTLVEFRNLENFKQGRWSNSYKLP    491 - 560
YSWIGTGHVVYNGAFYYNRAFTRNIIKYDLKQRYVAAWAMLHDVAYEEATPWRWQGHSDVDFAVDENGLW    561 - 630
LIYPALDDEGFSQEVIVLSKLNAADLSTQKETTWRTGLRRNFYGNCFVICGVLYAVDSYNQRNANISYAF    631 - 700
DTHTNTQIVPRLLFENEYSYTTQIDYNPKDRLLYAWDNGHQVTYHVIFAY                        701 - 750
//

Text Mined References (12)

PMID Year Title