Property Summary

NCBI Gene PubMed Count 33
PubMed Score 51.17
PubTator Score 46.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
adrenocortical adenoma -1.331 4.4e-04
adrenocortical carcinoma -2.152 2.7e-05
Astrocytoma, Pilocytic 1.500 2.0e-05
Breast cancer -3.500 3.5e-02
breast carcinoma -1.400 3.1e-04
diabetes mellitus -1.600 1.1e-02
ductal carcinoma in situ -1.500 1.3e-03
gastric cancer 1.200 1.6e-02
hepatocellular carcinoma 1.100 2.0e-04
interstitial cystitis 1.200 2.8e-02
intraductal papillary-mucinous adenoma (... -1.700 2.0e-03
intraductal papillary-mucinous carcinoma... -1.500 4.7e-03
intraductal papillary-mucinous neoplasm ... -1.600 4.8e-02
invasive ductal carcinoma -2.000 3.2e-02
lung cancer -5.700 1.8e-07
lung carcinoma -4.800 3.5e-34
mucosa-associated lymphoid tissue lympho... 1.901 6.1e-03
nasopharyngeal carcinoma -1.500 6.5e-06
non-small cell lung cancer -1.104 3.3e-08
osteosarcoma -2.076 4.5e-02
pancreatic cancer 1.800 1.3e-03
pancreatic carcinoma 1.800 1.3e-03
pancreatic ductal adenocarcinoma liver m... -2.096 4.7e-04
pituitary cancer -1.500 7.4e-05
psoriasis 1.300 3.3e-05
sonic hedgehog group medulloblastoma 1.300 1.7e-03
spina bifida -1.398 4.0e-02
tuberculosis 1.600 4.5e-03
ulcerative colitis 2.800 3.2e-06

Gene RIF (31)

AA Sequence

MEKTCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEA      1 - 70
AKKSGIIIIAIHREHYDFLTELTEVLNGKILVDISNNLKINQYPESNAEYLAHLVPGAHVVKAFNTISAW     71 - 140
ALQSGALDASRQVFVCGNDSKAKQRVMDIVRNLGLTPMDQGSLMAAKEIEKYPLQLFPMWRFPFYLSAVL    141 - 210
CVFLFFYCVIRDVIYPYVYEKKDNTFRMAISIPNRIFPITALTLLALVYLPGVIAAILQLYRGTKYRRFP    211 - 280
DWLDHWMLCRKQLGLVALGFAFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVA    281 - 350
LGILGFFLFVLLGITSLPSVSNAVNWREFRFVQSKLGYLTLILCTAHTLVYGGKRFLSPSNLRWYLPAAY    351 - 420
VLGLIIPCTVLVIKFVLIMPCVDNTLTRIRQGWERNSKH                                   421 - 459
//

Text Mined References (39)

PMID Year Title