Property Summary

NCBI Gene PubMed Count 29
Grant Count 6
R01 Count 4
Funding $198,195.14
PubMed Score 46.35
PubTator Score 46.16

Knowledge Summary

Patent

No data available

Expression

Gene RIF (27)

PMID Text
26510124 Some SNPs of the STEAP4 gene altered the risk of developing a metabolic syndrome in the Han Chinese population.
25680860 These data suggest that STAMP2 is required for prostate cancer progression and thus may serve as a novel therapeutic target.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of STEAP family member 4 (STEAP4; TNFAIP9) in primary human brain microvascular endothelial cells
24643198 may interact with mitochondria [review]
23953178 Our findings revealed that STAMP2 gene polymorphisms are likely to significantly contribute to the risk of MetS in male Han Chinese population.
23553608 STEAP4 was highly induced in human adipose cells differentiated in the presence of 1,25D.
23179203 Our results show increased mRNA expression of STEAP4 and NGAL in human visceral adipose tissue in obese patients.
23134829 three polymorphisms (rs8122, rs1981529 and rs34741656) of STAMP2 gene may be not related with type 2 diabetes mellitus in Xinjiang Uygur population
23095254 STAMP2 antagonizes HBx-mediated hepatocyte dysfunction, thereby protecting hepatocytes from hepatitis B virus gene expression.
22244520 STEAP4 is expressed on monocytes and neutrophils in peripheral blood of patients with rheumatoid arthritis.
More...

AA Sequence

MEKTCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEA      1 - 70
AKKSGIIIIAIHREHYDFLTELTEVLNGKILVDISNNLKINQYPESNAEYLAHLVPGAHVVKAFNTISAW     71 - 140
ALQSGALDASRQVFVCGNDSKAKQRVMDIVRNLGLTPMDQGSLMAAKEIEKYPLQLFPMWRFPFYLSAVL    141 - 210
CVFLFFYCVIRDVIYPYVYEKKDNTFRMAISIPNRIFPITALTLLALVYLPGVIAAILQLYRGTKYRRFP    211 - 280
DWLDHWMLCRKQLGLVALGFAFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVA    281 - 350
LGILGFFLFVLLGITSLPSVSNAVNWREFRFVQSKLGYLTLILCTAHTLVYGGKRFLSPSNLRWYLPAAY    351 - 420
VLGLIIPCTVLVIKFVLIMPCVDNTLTRIRQGWERNSKH                                   421 - 459
//

Text Mined References (35)

PMID Year Title
26510124 2015 Genetic Variants in Six-Transmembrane Epithelial Antigen of Prostate 4 Increase Risk of Developing Metabolic Syndrome in a Han Chinese Population.
25680860 2015 STAMP2 increases oxidative stress and is critical for prostate cancer.
24643198 2014 STAMPing into Mitochondria.
23953178 Association of the six transmembrane protein of prostate 2 gene polymorphisms with metabolic syndrome in Han Chinese population.
23553608 2013 Induction of STEAP4 correlates with 1,25-dihydroxyvitamin D3 stimulation of adipogenesis in mesenchymal progenitor cells derived from human adipose tissue.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23179203 2013 Six-transmembrane epithelial antigen of prostate 4 and neutrophil gelatinase-associated lipocalin expression in visceral adipose tissue is related to iron status and inflammation in human obesity.
23134829 2012 Genetic polymorphism of six transmembrane protein of prostate 2 associated with diabetes mellitus in Xinjiang Uygur population.
23095254 2012 Hepatic STAMP2 decreases hepatitis B virus X protein-associated metabolic deregulation.
22244520 Six-transmembrane epithelial antigen of prostate 4 (STEAP4) is expressed on monocytes/neutrophils, and is regulated by TNF antagonist in patients with rheumatoid arthritis.
More...