Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.28
PubTator Score 1.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.400 0.034
oligodendroglioma -1.400 0.036
osteosarcoma -1.422 0.001
atypical teratoid / rhabdoid tumor 1.100 0.000
glioblastoma 1.100 0.000
medulloblastoma 1.200 0.000
medulloblastoma, large-cell 1.300 0.001
pancreatic ductal adenocarcinoma liver m... -2.206 0.005
active Crohn's disease 1.060 0.023
lung carcinoma 1.200 0.000
ovarian cancer 1.300 0.001

Gene RIF (2)

PMID Text
22327645 The promoter of the gene of La ribonucleoprotein domain family (LARP2) was significantly hypermethylated in beta-thalassemia, and the expression of LARP2 was significantly lower in beta-thalassemia.
12045101 Review discusses the La motif, found in this protein.

AA Sequence

MENWPTPSELVNTGFQSVLSQGNKKPQNRKEKEEKVEKRSNSDSKENRETKLNGPGENVSEDEAQSSNQR      1 - 70
KRANKHKWVPLHLDVVRSESQERPGSRNSSRCQPEANKPTHNNRRNDTRSWKRDREKRDDQDDVSSVRSE     71 - 140
GGNIRGSFRGRGRGRGRGRGRGRGNPRLNFDYSYGYQEHGERTDQPFQTELNTSMMYYYDDGTGVQVYPV    141 - 210
EEALLKEYIKRQIEYYFSVENLERDFFLRGKMDEQGFLPISLIAGFQRVQALTTNLNLILEALKDSTEVE    211 - 280
IVDEKMRKKIEPEKWPIPGPPPRSVPPTDFSQLIDCPEFVPGQAFCSHTESAPNSPRIGSPLSPKKNSET    281 - 350
SILQAMSRGLSTSLPDLDSEPWIEVKKRHQPAPVKLRESVSVPEGSLNQLCSSEEPEQEELDFLFDEEIE    351 - 420
QIGRKNTFTDWSDNDSDYEIDDQDLNKILIVTQTPPYVKKHPGGDRTGTHMSRAKITSELAKVINDGLYY    421 - 490
YEQDLWMEEDENKHTAIKQEVENFKKLNLISKEQFENLTPELPFEPNQEVPVAPSQSRQGGVQGVLHIPK    491 - 560
KDLTDELAQKLFDVSEITSAAMVHSLPTAVPESPRIHPTRTPKTPRTPRLQDPNKTPRFYPVVKEPKAID    561 - 630
VKSPRKRKTRHSTNPPLECHVGWVMDSRDRGPGTSSVSTSNASPSEGAPLAGSYGCTPHSFPKFQHPSHE    631 - 700
LLKENGFTQQVYHKYRRRCLSERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFRQLAWEDAKENYR    701 - 770
YGLECLFRFYSYGLEKKFRREIFQDFQEETKKDYESGQLYGLEKFWAYLKYSQSKTQSIDPKLQEYLCSF    771 - 840
KRLEDFRVDPPISDEFGRKRHSSTSGEESNRHRLPPNSSTKPPNAAKPTSTSELQVPINSPRRNISPESS    841 - 910
DNSH                                                                      911 - 914
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22327645 2012 Hypermethylation of the gene LARP2 for noninvasive prenatal diagnosis of ?-thalassemia based on DNA methylation profile.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...