Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.28
PubTator Score 1.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease 1.017 9.2e-03
astrocytic glioma -1.400 3.4e-02
atypical teratoid / rhabdoid tumor 1.100 1.4e-04
glioblastoma 1.100 1.4e-04
lung carcinoma 1.200 1.2e-25
medulloblastoma 1.200 6.2e-06
medulloblastoma, large-cell 1.300 5.4e-04
oligodendroglioma -1.400 3.6e-02
osteosarcoma -1.422 8.9e-04
ovarian cancer 1.300 5.8e-04
pancreatic ductal adenocarcinoma liver m... -2.206 5.2e-03

 GO Function (1)

 GO Component (1)

 Compartment GO Term (3)

Gene RIF (2)

AA Sequence

MENWPTPSELVNTGFQSVLSQGNKKPQNRKEKEEKVEKRSNSDSKENRETKLNGPGENVSEDEAQSSNQR      1 - 70
KRANKHKWVPLHLDVVRSESQERPGSRNSSRCQPEANKPTHNNRRNDTRSWKRDREKRDDQDDVSSVRSE     71 - 140
GGNIRGSFRGRGRGRGRGRGRGRGNPRLNFDYSYGYQEHGERTDQPFQTELNTSMMYYYDDGTGVQVYPV    141 - 210
EEALLKEYIKRQIEYYFSVENLERDFFLRGKMDEQGFLPISLIAGFQRVQALTTNLNLILEALKDSTEVE    211 - 280
IVDEKMRKKIEPEKWPIPGPPPRSVPPTDFSQLIDCPEFVPGQAFCSHTESAPNSPRIGSPLSPKKNSET    281 - 350
SILQAMSRGLSTSLPDLDSEPWIEVKKRHQPAPVKLRESVSVPEGSLNQLCSSEEPEQEELDFLFDEEIE    351 - 420
QIGRKNTFTDWSDNDSDYEIDDQDLNKILIVTQTPPYVKKHPGGDRTGTHMSRAKITSELAKVINDGLYY    421 - 490
YEQDLWMEEDENKHTAIKQEVENFKKLNLISKEQFENLTPELPFEPNQEVPVAPSQSRQGGVQGVLHIPK    491 - 560
KDLTDELAQKLFDVSEITSAAMVHSLPTAVPESPRIHPTRTPKTPRTPRLQDPNKTPRFYPVVKEPKAID    561 - 630
VKSPRKRKTRHSTNPPLECHVGWVMDSRDRGPGTSSVSTSNASPSEGAPLAGSYGCTPHSFPKFQHPSHE    631 - 700
LLKENGFTQQVYHKYRRRCLSERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFRQLAWEDAKENYR    701 - 770
YGLECLFRFYSYGLEKKFRREIFQDFQEETKKDYESGQLYGLEKFWAYLKYSQSKTQSIDPKLQEYLCSF    771 - 840
KRLEDFRVDPPISDEFGRKRHSSTSGEESNRHRLPPNSSTKPPNAAKPTSTSELQVPINSPRRNISPESS    841 - 910
DNSH                                                                      911 - 914
//

Text Mined References (20)

PMID Year Title