Property Summary

NCBI Gene PubMed Count 20
PubMed Score 90.95
PubTator Score 18.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
ulcerative colitis 2087 0.001128914789356
ductal carcinoma in situ 1745 0.00179730021431298
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0115310916598898
osteosarcoma 7933 0.0116463421023181
astrocytic glioma 2241 0.0131093876156842
invasive ductal carcinoma 2950 0.0163121795261569
Breast cancer 3099 0.0298995673870555
Rheumatoid Arthritis 1171 0.0394969249911339

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis 1.700 0.039
astrocytic glioma -1.300 0.013
osteosarcoma 1.180 0.012
intraductal papillary-mucinous carcinoma... 1.200 0.012
Breast cancer 3.000 0.030
ductal carcinoma in situ 1.300 0.002
invasive ductal carcinoma 1.100 0.016
ulcerative colitis -1.400 0.001

Synonym

Accession Q63HQ0 B2RCV7 Q96GG6 Q9H0V0 Q9P1L4
Symbols 2C18
GBAR
C4orf16
PRO0971
gamma-BAR

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (4)

PMID Text
21525240 conclude that a specific fraction of the AP2-derived endocytic pathway is dedicated to secretory purposes under the control of AP1 and Gadkin
20332099 Observational study of gene-disease association. (HuGE Navigator)
19965873 Studies unravel the molecular basis for Gadkin-mediated AP-1 recruitment to TGN/endosomal membranes and identify a novel subtype of the AP-1-binding motif.
19706427 Gadkin (gamma-BAR), a peripheral membrane protein localized to the trans-Golgi network and to endosomal vesicles, directly associates with the clathrin adaptor AP-1 and the motor protein kinesin KIF5, potentially regulating endosomal vesicle dynamics.

AA Sequence

MGNCCWTQCFGLLRKEAGRLQRVGGGGGSKYFRTCSRGEHLTIEFENLVESDEGESPGSSHRPLTEEEIV      1 - 70
DLRERHYDSIAEKQKDLDKKIQKELALQEEKLRLEEEALYAAQREAARAAKQRKLLEQERQRIVQQYHPS     71 - 140
NNGEYQSSGPEDDFESCLRNMKSQYEVFRSSRLSSDATVLTPNTESSCDLMTKTKSTSGNDDSTSLDLEW    141 - 210
EDEEGMNRMLPMRERSKTEEDILRAALKYSNKKTGSNPTSASDDSNGLEWENDFVSAEMDDNGNSEYSGF    211 - 280
VNPVLELSDSGIRHSDTDQQTR                                                    281 - 302
//

Text Mined References (24)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22689987 2012 Gadkin negatively regulates cell spreading and motility via sequestration of the actin-nucleating ARP2/3 complex.
21525240 2011 Role of AP1 and Gadkin in the traffic of secretory endo-lysosomes.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
19965873 2010 A novel subtype of AP-1-binding motif within the palmitoylated trans-Golgi network/endosomal accessory protein Gadkin/gamma-BAR.
19706427 2009 Regulation of endosomal membrane traffic by a Gadkin/AP-1/kinesin KIF5 complex.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16381901 2006 The LIFEdb database in 2006.
More...