Property Summary

NCBI Gene PubMed Count 20
Grant Count 3
Funding $27,786.5
PubMed Score 90.95
PubTator Score 18.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis 1.700 0.039
astrocytic glioma -1.300 0.013
osteosarcoma 1.180 0.012
intraductal papillary-mucinous carcinoma... 1.200 0.012
Breast cancer 3.000 0.030
ductal carcinoma in situ 1.300 0.002
invasive ductal carcinoma 1.100 0.016
ulcerative colitis -1.400 0.001

Synonym

Accession Q63HQ0 B2RCV7 Q96GG6 Q9H0V0 Q9P1L4
Symbols 2C18
GBAR
C4orf16
PRO0971
gamma-BAR

Gene

Gene RIF (4)

PMID Text
21525240 conclude that a specific fraction of the AP2-derived endocytic pathway is dedicated to secretory purposes under the control of AP1 and Gadkin
20332099 Observational study of gene-disease association. (HuGE Navigator)
19965873 Studies unravel the molecular basis for Gadkin-mediated AP-1 recruitment to TGN/endosomal membranes and identify a novel subtype of the AP-1-binding motif.
19706427 Gadkin (gamma-BAR), a peripheral membrane protein localized to the trans-Golgi network and to endosomal vesicles, directly associates with the clathrin adaptor AP-1 and the motor protein kinesin KIF5, potentially regulating endosomal vesicle dynamics.

AA Sequence

MGNCCWTQCFGLLRKEAGRLQRVGGGGGSKYFRTCSRGEHLTIEFENLVESDEGESPGSSHRPLTEEEIV      1 - 70
DLRERHYDSIAEKQKDLDKKIQKELALQEEKLRLEEEALYAAQREAARAAKQRKLLEQERQRIVQQYHPS     71 - 140
NNGEYQSSGPEDDFESCLRNMKSQYEVFRSSRLSSDATVLTPNTESSCDLMTKTKSTSGNDDSTSLDLEW    141 - 210
EDEEGMNRMLPMRERSKTEEDILRAALKYSNKKTGSNPTSASDDSNGLEWENDFVSAEMDDNGNSEYSGF    211 - 280
VNPVLELSDSGIRHSDTDQQTR                                                    281 - 302
//

Text Mined References (24)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22689987 2012 Gadkin negatively regulates cell spreading and motility via sequestration of the actin-nucleating ARP2/3 complex.
21525240 2011 Role of AP1 and Gadkin in the traffic of secretory endo-lysosomes.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
19965873 2010 A novel subtype of AP-1-binding motif within the palmitoylated trans-Golgi network/endosomal accessory protein Gadkin/gamma-BAR.
19706427 2009 Regulation of endosomal membrane traffic by a Gadkin/AP-1/kinesin KIF5 complex.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16381901 2006 The LIFEdb database in 2006.
More...