Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.41
PubTator Score 0.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Fanconi's anemia 50 3.563 1.8

Synonym

Accession Q5YKI7 Q5YKI8
Symbols

Gene

Gene RIF (3)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15625700 A testicular germ cell-specific protein interacting with GGN1. The protein seems to associate with the membrane system in the germ cell.

AA Sequence

MKEEDSSFKLCVPGIVALQSPPNKAFRSTDTVGFLESELKKLLGMQQESRLWKLGSQEGRELLTRPEITV      1 - 70
VEGEGYEVQRRLRHLPSPISVAQCLLLEEKGEMGNWPPE                                    71 - 109
//

Text Mined References (5)

PMID Year Title
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
15642376 2005 Yeast two-hybrid screens imply that GGNBP1, GGNBP2 and OAZ3 are potential interaction partners of testicular germ cell-specific protein GGN1.
15625700 2005 Identification and characterization of a novel testicular germ cell-specific gene Ggnbp1.
14574404 2003 The DNA sequence and analysis of human chromosome 6.