Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.41
PubTator Score 0.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Fanconi anemia 56 3.581 1.8

Gene RIF (3)

AA Sequence

MKEEDSSFKLCVPGIVALQSPPNKAFRSTDTVGFLESELKKLLGMQQESRLWKLGSQEGRELLTRPEITV      1 - 70
VEGEGYEVQRRLRHLPSPISVAQCLLLEEKGEMGNWPPE                                    71 - 109
//

Text Mined References (5)

PMID Year Title