Property Summary

NCBI Gene PubMed Count 24
Grant Count 4
R01 Count 4
Funding $192,368
PubMed Score 1.34
PubTator Score 11.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.800 0.000
glioblastoma -1.300 0.002
medulloblastoma, large-cell -1.700 0.001
Breast cancer -3.200 0.026
pediatric high grade glioma -1.200 0.001
posterior fossa group A ependymoma -1.500 0.000
subependymal giant cell astrocytoma -1.285 0.010
gastric carcinoma 1.100 0.016
ovarian cancer -1.500 0.000
pituitary cancer -1.600 0.000

Synonym

Accession Q5XUX0 Q5K680 Q8WYV1 Q96D73 Q9UFV4
Symbols FBX14
Fbx31
MRT45
FBXO14
pp2386

Gene

Gene RIF (10)

PMID Text
26124108 FBXO31-mediated loss of MDM2 leads to elevated levels of p53, resulting in growth arrest. In cells depleted of FBXO31, MDM2 is not degraded and p53 levels do not increase following genotoxic stress
25115392 Expression of FBXO31 inhibited xenograft tumor growth in mice. miR-20a and miR-17 mimics inhibited, whereas the inhibitor of miR-20a and miR-17 increased, the expression of FBXO31, respectively. miR-20a and miR-17 directly bind to the 3'-UTR of FBXO31.
24936062 uncover a new mechanism of deactivation of MKK6-p38 and substantiate a novel regulatory role of FBXO31 in stress response
24828503 FBXO31 interacts with Cdt1 and regulates the degradation of Cdt1 in G2 phase.
24623383 Truncation of the E3 ubiquitin ligase component FBXO31 causes non-syndromic autosomal recessive intellectual disability.
23469015 ascribe a role for FBXO31 in dendrite growth and neuronal migration in the developing cerebellar cortex. Taken together, we uncovered the centrosomal E3 ligase FBXO31-SCF as a novel regulator of neuronal development
22632973 The Skp2 SCF complex, not TRAF6, is a critical E3 ligase for ErbB-receptor-mediated Akt ubiquitination and membrane recruitment in response to EGF.
21537837 CGH array indicated that cases having cyclin D1 with increased copy number were significantly associated with elevated FBXO31 expression levels (P<0.05). FBXO31 could be a novel and robust prognostic marker for ESCC.
19412162 ectopic expression of FBXO31 acts through a proteasome-directed pathway to mediate the degradation of cyclin D1, an important regulator of progression from G1 to S phase, resulting in arrest in G1
16357137 Loss of FBXO31 is associated with breast cancer

AA Sequence

MAVCARLCGVGPSRGCRRRQQRRGPAETAAADSEPDTDPEEERIEASAGVGGGLCAGPSPPPPRCSLLEL      1 - 70
PPELLVEIFASLPGTDLPSLAQVCTKFRRILHTDTIWRRRCREEYGVCENLRKLEITGVSCRDVYAKLLH     71 - 140
RYRHILGLWQPDIGPYGGLLNVVVDGLFIIGWMYLPPHDPHVDDPMRFKPLFRIHLMERKAATVECMYGH    141 - 210
KGPHHGHIQIVKKDEFSTKCNQTDHHRMSGGRQEEFRTWLREEWGRTLEDIFHEHMQELILMKFIYTSQY    211 - 280
DNCLTYRRIYLPPSRPDDLIKPGLFKGTYGSHGLEIVMLSFHGRRARGTKITGDPNIPAGQQTVEIDLRH    281 - 350
RIQLPDLENQRNFNELSRIVLEVRERVRQEQQEGGHEAGEGRGRQGPRESQPSPAQPRAEAPSKGPDGTP    351 - 420
GEDGGEPGDAVAAAEQPAQCGQGQPFVLPVGVSSRNEDYPRTCRMCFYGTGLIAGHGFTSPERTPGVFIL    421 - 490
FDEDRFGFVWLELKSFSLYSRVQATFRNADAPSPQAFDEMLKNIQSLTS                         491 - 539
//

Text Mined References (27)

PMID Year Title
26124108 2015 F-box protein FBXO31 directs degradation of MDM2 to facilitate p53-mediated growth arrest following genotoxic stress.
25115392 2014 F-box protein FBXO31 is down-regulated in gastric cancer and negatively regulated by miR-17 and miR-20a.
24936062 2014 F-box only protein 31 (FBXO31) negatively regulates p38 mitogen-activated protein kinase (MAPK) signaling by mediating lysine 48-linked ubiquitination and degradation of mitogen-activated protein kinase kinase 6 (MKK6).
24828503 2014 SCF-FBXO31 E3 ligase targets DNA replication factor Cdt1 for proteolysis in the G2 phase of cell cycle to prevent re-replication.
24623383 2014 Truncation of the E3 ubiquitin ligase component FBXO31 causes non-syndromic autosomal recessive intellectual disability in a Pakistani family.
24554482 2014 Genome-wide association study of peripheral neuropathy with D-drug-containing regimens in AIDS Clinical Trials Group protocol 384.
23469015 2013 The centrosomal E3 ubiquitin ligase FBXO31-SCF regulates neuronal morphogenesis and migration.
22632973 2012 The Skp2-SCF E3 ligase regulates Akt ubiquitination, glycolysis, herceptin sensitivity, and tumorigenesis.
22472876 2013 A mega-analysis of genome-wide association studies for major depressive disorder.
21537837 2011 FBXO31 determines poor prognosis in esophageal squamous cell carcinoma.
More...