Property Summary

NCBI Gene PubMed Count 25
PubMed Score 2.03
PubTator Score 11.47

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 1.3e-07
Breast cancer -3.200 2.6e-02
gastric carcinoma 1.100 1.6e-02
glioblastoma -1.300 1.5e-03
medulloblastoma, large-cell -1.100 1.3e-04
ovarian cancer -1.500 2.5e-08
pediatric high grade glioma -1.200 9.6e-04
pituitary cancer -1.600 3.9e-06
posterior fossa group A ependymoma -1.500 2.2e-09
subependymal giant cell astrocytoma -1.285 9.7e-03

 IMPC Phenotype (1)

Gene RIF (11)

AA Sequence

MAVCARLCGVGPSRGCRRRQQRRGPAETAAADSEPDTDPEEERIEASAGVGGGLCAGPSPPPPRCSLLEL      1 - 70
PPELLVEIFASLPGTDLPSLAQVCTKFRRILHTDTIWRRRCREEYGVCENLRKLEITGVSCRDVYAKLLH     71 - 140
RYRHILGLWQPDIGPYGGLLNVVVDGLFIIGWMYLPPHDPHVDDPMRFKPLFRIHLMERKAATVECMYGH    141 - 210
KGPHHGHIQIVKKDEFSTKCNQTDHHRMSGGRQEEFRTWLREEWGRTLEDIFHEHMQELILMKFIYTSQY    211 - 280
DNCLTYRRIYLPPSRPDDLIKPGLFKGTYGSHGLEIVMLSFHGRRARGTKITGDPNIPAGQQTVEIDLRH    281 - 350
RIQLPDLENQRNFNELSRIVLEVRERVRQEQQEGGHEAGEGRGRQGPRESQPSPAQPRAEAPSKGPDGTP    351 - 420
GEDGGEPGDAVAAAEQPAQCGQGQPFVLPVGVSSRNEDYPRTCRMCFYGTGLIAGHGFTSPERTPGVFIL    421 - 490
FDEDRFGFVWLELKSFSLYSRVQATFRNADAPSPQAFDEMLKNIQSLTS                         491 - 539
//

Text Mined References (28)

PMID Year Title