Property Summary

NCBI Gene PubMed Count 14
Grant Count 171
R01 Count 95
Funding $62,085,552.41
PubMed Score 206.21
PubTator Score 17.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
group 3 medulloblastoma 1.100 0.009
subependymal giant cell astrocytoma -1.154 0.005
ovarian cancer 1.100 0.000

Synonym

Accession Q5XG87 A8K1E2 M1JCE6 O43289 Q17RZ1 Q9Y6C1
Symbols LAK1
POLK
POLS
TRF4
LAK-1
TRF41
TRF4-1
TUTASE5

Gene

Gene RIF (4)

PMID Text
23376078 These results suggest that PAPD7 l is the major and active isoform of PAPD7 expressed in cells.
19240061 Observational study of gene-disease association. (HuGE Navigator)
18421076 Observational study of gene-disease association. (HuGE Navigator)
18330920 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MQIWETSQGVGRGGSGFASYFCLNSPALDTAAAAGAAGRGSGGLGPALPAASPPPPGPTAPAALPPALLT      1 - 70
ALGPAAEGARRLHKSPSLSSSSSSSSSNAESGTESPGCSSSSSSSASLGRPGGGRGGAFFNFADGAPSAP     71 - 140
GTANGHPGPRGPAPAGSPSQHQFHPGRRKRENKASTYGLNYLLSGSRAAALSGGGGPGAQAPRPGTPWKS    141 - 210
RAYSPGIQGLHEEIIDFYNFMSPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDL    211 - 280
VVFGKWERPPLQLLEQALRKHNVAEPCSIKVLDKATVPIIKLTDQETEVKVDISFNMETGVRAAEFIKNY    281 - 350
MKKYSLLPYLILVLKQFLLQRDLNEVFTGGISSYSLILMAISFLQLHPRIDARRADENLGMLLVEFFELY    351 - 420
GRNFNYLKTGIRIKEGGAYIAKEEIMKAMTSGYRPSMLCIEDPLLPGNDVGRSSYGAMQVKQVFDYAYIV    421 - 490
LSHAVSPLARSYPNRDAESTLGRIIKVTQEVIDYRRWIKEKWGSKAHPSPGMDSRIKIKERIATCNGEQT    491 - 560
QNREPESPYGQRLTLSLSSPQLLSSGSSASSVSSLSGSDVDSDTPPCTTPSVYQFSLQAPAPLMAGLPTA    561 - 630
LPMPSGKPQPTTSRTLIMTTNNQTRFTIPPPTLGVAPVPCRQAGVEGTASLKAVHHMSSPAIPSASPNPL    631 - 700
SSPHLYHKQHNGMKLSMKGSHGHTQGGGYSSVGSGGVRPPVGNRGHHQYNRTGWRRKKHTHTRDSLPVSL    701 - 770
SR                                                                        771 - 772
//

Text Mined References (17)

PMID Year Title
23776197 2013 Genome-wide association study identifies ephrin type A receptors implicated in paclitaxel induced peripheral sensory neuropathy.
23548203 2013 Genome-wide association studies identify several new loci associated with pigmentation traits and skin cancer risk in European Americans.
23376078 2013 Molecular cloning and characterization of a novel isoform of the non-canonical poly(A) polymerase PAPD7.
22817747 2012 Comparison of the yeast and human nuclear exosome complexes.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18821564 2008 Genome-wide association study of response to methylphenidate in 187 children with attention-deficit/hyperactivity disorder.
18421076 2008 A genome-wide scan maps a novel high myopia locus to 5p15.
18330920 2008 Discovery of genetic profiles impacting response to chemotherapy: application to gemcitabine.
More...