Property Summary

NCBI Gene PubMed Count 4
PubMed Score 12.96
PubTator Score 3.17

Knowledge Summary


No data available

Gene RIF (3)

26836020 RESP18HD is required for efficient sorting of ICA512 to secretory granules: RESP18HD is a key determinant for ICA512 granule targeting.
23319378 Over-expression of RESP18 resulted in aggravated cell death induced by dopaminergic neurotoxins.
17951542 RESP18 is a luminal protein of DCVs and its expression is regulated by exposure to glucose.

AA Sequence

SEVVSKALKQEVANPVKGFSGPLPTVGRNPVAD                                         141 - 173

Text Mined References (5)

PMID Year Title
26836020 2016 Biochemical, biophysical, and functional properties of ICA512/IA-2 RESP18 homology domain.
23319378 2013 RESP18 is involved in the cytotoxicity of dopaminergic neurotoxins in MN9D cells.
17951542 2007 RESP18, a homolog of the luminal domain IA-2, is found in dense core vesicles in pancreatic islet cells and is induced by high glucose.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
7988462 1994 Regulated endocrine-specific protein-18: a short-lived novel glucocorticoid-regulated endocrine protein.