Property Summary

NCBI Gene PubMed Count 4
PubMed Score 13.00
PubTator Score 3.17

Knowledge Summary

Patent

No data available

Gene RIF (3)

AA Sequence

MQHPLWPGSSEGLQLLVCFLLLNSCPGGCSDTSAHDGQDQVGVGQLWPLQGFATPVFQHLQVVLQQIIPQ      1 - 70
GLFWKDDITQDAMIQKMEHASRLHPQEPCLKDGKALFPTKTTEQEEKLQLLFPSETHSPLAKVNRDQCFT     71 - 140
SEVVSKALKQEVANPVKGFSGPLPTVGRNPVAD                                         141 - 173
//

Text Mined References (5)

PMID Year Title