Property Summary

NCBI Gene PubMed Count 25
PubMed Score 23.00
PubTator Score 18.69

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count
Platelet mean volume finding 31
Disease Target Count P-value
malignant mesothelioma 3163 2.32196487676941E-7
group 4 medulloblastoma 1875 6.29006272273372E-7
pilocytic astrocytoma 3086 7.07244903930414E-7
ovarian cancer 8492 1.03983657598572E-5
osteosarcoma 7933 1.54605895220694E-5
medulloblastoma, large-cell 6234 7.15720170737654E-5
primitive neuroectodermal tumor 3031 8.69240792896848E-4
psoriasis 6685 9.90453821613913E-4
glioblastoma 5572 0.00248999391091887
atypical teratoid / rhabdoid tumor 4369 0.00286386266178072
pituitary cancer 1972 0.00299905452768439
Rheumatoid Arthritis 1171 0.00707566363676864
astrocytic glioma 2241 0.0161751922579465
acute myeloid leukemia 785 0.0339857801112801
oligodendroglioma 2849 0.0494745089411716
Disease Target Count Z-score Confidence
Gout 93 4.267 2.1
Iron metabolism disease 17 0.0 2.0
Multiple Sclerosis 498 0.0 1.0
Disease Target Count Z-score Confidence
Acute urate nephropathy 6 4.291 2.1


  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis -1.100 0.007
malignant mesothelioma -2.300 0.000
astrocytic glioma -1.600 0.016
oligodendroglioma -1.200 0.049
psoriasis -1.100 0.001
osteosarcoma -1.728 0.000
glioblastoma -1.100 0.002
atypical teratoid / rhabdoid tumor -1.300 0.003
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.900 0.001
group 4 medulloblastoma -1.900 0.000
pilocytic astrocytoma -1.800 0.000
acute myeloid leukemia -1.300 0.034
ovarian cancer -1.400 0.000
pituitary cancer 1.100 0.003


Accession Q5VZK9 B8X1J0 Q6ZUH5 Q6ZW07 Q9NXU7
Symbols CARMIL



3LK2   3LK3  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Horse OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

 GO Function (1)

Gene RIF (13)

25254322 LRRC16A plays a role in adult respiratory distress syndrome pathophysiology by interacting with, and being mediated through, platelets.
24318514 shown for the first time that CARMIL/LRRC16A was associated with gout, which could be due to urate transportsome failure
23904264 The results also suggest that the ability of CARMIL1 to inhibit CP in cells may be regulated.
22411988 Data suggest that CARMIL promotes uncapping by binding to a freely accessible site on Capping protein (CP) bound to a filament barbed end and inducing a change in the conformation of the actin-binding surface of CP.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20162743 Observational study of gene-disease association. (HuGE Navigator)
20162742 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19890391 Observational study of gene-disease association. (HuGE Navigator)
19861489 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

SWGQQAQEYQEQKQRSSSKDGHQGSKSNDSGEEAEKEFIFV                                1331 - 1371

Text Mined References (36)

PMID Year Title
26578515 2016 Cell Migration and Invadopodia Formation Require a Membrane-binding Domain of CARMIL2.
25254322 2015 Platelet count mediates the contribution of a genetic variant in LRRC16A to ARDS risk.
24318514 2014 Common variant of leucine-rich repeat-containing 16A (LRRC16A) gene is associated with gout susceptibility.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23904264 2013 Physiological role of the interaction between CARMIL1 and capping protein.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22423221 2012 A meta-analysis and genome-wide association study of platelet count and mean platelet volume in african americans.
22411988 2012 Mechanism for CARMIL protein inhibition of heterodimeric actin-capping protein.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.