Property Summary

NCBI Gene PubMed Count 26
PubMed Score 24.08
PubTator Score 18.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute myeloid leukemia -1.300 3.4e-02
astrocytic glioma -1.600 1.6e-02
Astrocytoma, Pilocytic -1.800 9.6e-07
atypical teratoid / rhabdoid tumor -1.300 2.9e-03
glioblastoma -1.100 2.5e-03
group 4 medulloblastoma -1.900 6.3e-07
malignant mesothelioma -2.300 2.3e-07
medulloblastoma, large-cell -1.900 7.2e-05
oligodendroglioma -1.200 4.9e-02
osteosarcoma -1.728 1.5e-05
ovarian cancer 1.100 9.2e-11
pituitary cancer 1.100 3.0e-03
primitive neuroectodermal tumor -1.900 8.7e-04
psoriasis -1.100 9.9e-04
Rheumatoid arthritis -1.100 7.1e-03

 GO Function (1)

Gene RIF (14)

AA Sequence

MTEESSDVPRELIESIKDVIGRKIKISVKKKVKLEVKGDKVENKVLVLTSCRAFLVTARIPTKLELTFSY      1 - 70
LEIHGVVCSKSAQMIVETEKCSISMKMASPEDVSEVLAHIGTCLRKIFPGLSPVRIMKKVSMEPSERLAS     71 - 140
LQALWDSQTVAEQGPCGGFSQMYACVCDWLGFSYREEVQWDVDTIYLTQDTRELNLQDFSHLDHRDLIPI    141 - 210
IAALEYNQWFTKLSSKDLKLSTDVCEQILRVVSRSNRLEELVLENAGLRTDFAQKLASALAHNPNSGLHT    211 - 280
INLAGNPLEDRGVSSLSIQFAKLPKGLKHLNLSKTSLSPKGVNSLSQSLSANPLTASTLVHLDLSGNVLR    281 - 350
GDDLSHMYNFLAQPNAIVHLDLSNTECSLDMVCGALLRGCLQYLAVLNLSRTVFSHRKGKEVPPSFKQFF    351 - 420
SSSLALMHINLSGTKLSPEPLKALLLGLACNHNLKGVSLDLSNCELRSGGAQVLEGCIAEIHNITSLDIS    421 - 490
DNGLESDLSTLIVWLSKNRSIQHLALGKNFNNMKSKNLTPVLDNLVQMIQDEESPLQSLSLADSKLKTEV    491 - 560
TIIINALGSNTSLTKVDISGNGMGDMGAKMLAKALQINTKLRTVIWDKNNITAQGFQDIAVAMEKNYTLR    561 - 630
FMPIPMYDASQALKTNPEKTEDALQKIENYLLRNHETRKYLQEQAYRLQQGIVTSTTQQMIDRICVKVQD    631 - 700
HLNSLRNCGGDAIQEDLKSAERLMRDAKNSKTLLPNLYHVGGASWAGASGLLSSPIQETLESMAGEVTRV    701 - 770
VDEQLKALLESMVDAAENLCPNVMKKAHIRQDLIHASTEKISIPRTFVKNVLLEQSGIDILNKISEVKLT    771 - 840
VASFLSDRIVDEILDALSHCHHKLADHFSRRGKTLPQQESLEIELAEEKPVKRSIITVEELTEIERLEDL    841 - 910
DTCMMTPKSKRKSIHSRMLRPVSRAFEMEFDLDKALEEVPIHIEDPPFPSLRQEKRSSGFISELPSEEGK    911 - 980
KLEHFTKLRPKRNKKQQPTQAAVCAANIVSQDGEQNGLMGRVDEGVDEFFTKKVTKMDSKKWSTRGSESH    981 - 1050
ELNEGGDEKKKRDSRKSSGFLNLIKSRSKSERPPTILMTEEPSSPKGAVRSPPVDCPRKDTKAAEHNGNS   1051 - 1120
ERIEEIKTPDSFEESQGEEIGKVERSDSKSSPQAGRRYGVQVMGSGLLAEMKAKQEKRAACAQKKLGNDA   1121 - 1190
VSQDSSSPALSGVERSDGGGAVPKLHPGLPENRFGLGTPEKNTKAEPKAEAGSRSRSSSSTPTSPKPLLQ   1191 - 1260
SPKPSLAARPVIPQKPRTASRPDDIPDSPSSPKVALLPPVLKKVPSDKERDGQSSPQPSPRTFSQEVSRR   1261 - 1330
SWGQQAQEYQEQKQRSSSKDGHQGSKSNDSGEEAEKEFIFV                                1331 - 1371
//

Text Mined References (37)

PMID Year Title