Property Summary

NCBI Gene PubMed Count 10
Grant Count 1
Funding $55,083.9
PubMed Score 24.03
PubTator Score 8.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 2.165 0.000
lung cancer 1.700 0.044
ovarian cancer 2.400 0.000

Synonym

Accession Q5VZE5 Q5VZE6 Q9H631 Q9H703
Symbols EGAP
MAK10
MAK10P
bA379P1.1

Gene

PANTHER Protein Class (2)

 Grant Application (1)

Gene RIF (2)

PMID Text
24243830 Data demonstrate that chimera GOLM1-MAK10 encodes a secreted fusion protein. Mechanistic studies reveal that GOLM1-MAK10 is likely derived from transcription read-through/splicing rather than being generated from a fusion gene.
19398576 Human Naa35 (MAK10) is an auxiliary subunit of the human NatC N-terminal acetyltransferase complex. NatC acetylates hydrophobic Met-starting N-termini, and NatC knockdown induces p53-dependent apoptosis.

AA Sequence

MVMKASVDDDDSGWELSMPEKMEKSNTNWVDITQDFEEACRELKLGELLHDKLFGLFEAMSAIEMMDPKM      1 - 70
DAGMIGNQVNRKVLNFEQAIKDGTIKIKDLTLPELIGIMDTCFCCLITWLEGHSLAQTVFTCLYIHNPDF     71 - 140
IEDPAMKAFALGILKICDIAREKVNKAAVFEEEDFQSMTYGFKMANSVTDLRVTGMLKDVEDDMQRRVKS    141 - 210
TRSRQGEERDPEVELEHQQCLAVFSRVKFTRVLLTVLIAFTKKETSAVAEAQKLMVQAADLLSAIHNSLH    211 - 280
HGIQAQNDTTKGDHPIMMGFEPLVNQRLLPPTFPRYAKIIKREEMVNYFARLIDRIKTVCEVVNLTNLHC    281 - 350
ILDFFCEFSEQSPCVLSRSLLQTTFLVDNKKVFGTHLMQDMVKDALRSFVSPPVLSPKCYLYNNHQAKDC    351 - 420
IDSFVTHCVRPFCSLIQIHGHNRARQRDKLGHILEEFATLQDEAEKVDAALHTMLLKQEPQRQHLACLGT    421 - 490
WVLYHNLRIMIQYLLSGFELELYSMHEYYYIYWYLSEFLYAWLMSTLSRADGSQMAEERIMEEQQKGRSS    491 - 560
KKTKKKKKVRPLSREITMSQAYQNMCAGMFKTMVAFDMDGKVRKPKFELDSEQVRYEHRFAPFNSVMTPP    561 - 630
PVHYLQFKEMSDLNKYSPPPQSPELYVAASKHFQQAKMILENIPNPDHEVNRILKVAKPNFVVMKLLAGG    631 - 700
HKKESKVPPEFDFSAHKYFPVVKLV                                                 701 - 725
//

Text Mined References (15)

PMID Year Title
24243830 2013 Aberrant chimeric RNA GOLM1-MAK10 encoding a secreted fusion protein as a molecular signature for human esophageal squamous cell carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19660095 2009 A synopsis of eukaryotic Nalpha-terminal acetyltransferases: nomenclature, subunits and substrates.
19398576 2009 Knockdown of human N alpha-terminal acetyltransferase complex C leads to p53-dependent apoptosis and aberrant human Arl8b localization.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16484612 2006 Embryonic growth-associated protein is one subunit of a novel N-terminal acetyltransferase complex essential for embryonic vascular development.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
More...