Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -3.300 0.000
osteosarcoma -3.668 0.000
lung cancer -1.500 0.000

AA Sequence

MSLNPSRPSSSELVELHVFYVPEGSWNYKLNTISTEVVNKFISAGFLRVSPQLTLRALRERLGEFLGEDA      1 - 70
IAEKFLFLKCIGNNLAVVKEKQESELKLKSFAPPYALQPELYLLPVMDHLGNVYSPSTVILDERQTNNGV     71 - 140
NEADGTIHRPISVTLFKEELGRDPSLLENTLKELPNKNQEEAGGKATAEKSQIAKNQIGNSELPGSLEDS    141 - 210
NNDCFGTKKSQCLWENEDDTAISRRQDNQTAEKEYITLPDHPSLPCQPVLSSGITDISLLQTEREKIIKQ    211 - 280
MKQVKEERRYLERNREELVKTVEKLFEQSKLKRYHAYNGWKKKYLETKKVTASMEEVLTKLREDLELYYK    281 - 350
KLLMQLEAREIKMRPKNLANITDSKNYLIIQITEVQHAIDQLKRKLDTDKMKLIVEVKMRKQAVSDLRTL    351 - 420
KTELAQKKKIIHLYNLN                                                         421 - 437
//

Text Mined References (5)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11181995 2001 The sequence of the human genome.