Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 5.6e-12
psoriasis 6694 5.9e-05
lung cancer 4740 3.2e-04

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer -1.500 3.2e-04
osteosarcoma -3.668 5.6e-12
psoriasis -3.300 5.9e-05

AA Sequence

MSLNPSRPSSSELVELHVFYVPEGSWNYKLNTISTEVVNKFISAGFLRVSPQLTLRALRERLGEFLGEDA      1 - 70
IAEKFLFLKCIGNNLAVVKEKQESELKLKSFAPPYALQPELYLLPVMDHLGNVYSPSTVILDERQTNNGV     71 - 140
NEADGTIHRPISVTLFKEELGRDPSLLENTLKELPNKNQEEAGGKATAEKSQIAKNQIGNSELPGSLEDS    141 - 210
NNDCFGTKKSQCLWENEDDTAISRRQDNQTAEKEYITLPDHPSLPCQPVLSSGITDISLLQTEREKIIKQ    211 - 280
MKQVKEERRYLERNREELVKTVEKLFEQSKLKRYHAYNGWKKKYLETKKVTASMEEVLTKLREDLELYYK    281 - 350
KLLMQLEAREIKMRPKNLANITDSKNYLIIQITEVQHAIDQLKRKLDTDKMKLIVEVKMRKQAVSDLRTL    351 - 420
KTELAQKKKIIHLYNLN                                                         421 - 437
//

Text Mined References (5)

PMID Year Title