Property Summary

NCBI Gene PubMed Count 5
PubMed Score 14.23
PubTator Score 13.43

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
21378161 CTRP13 reduces glucose output in hepatocytes by inhibiting the mRNA expression of gluconeogenic enzymes, glucose-6-phosphatase and the cytosolic form of phosphoenolpyruvate carboxykinase.

AA Sequence

MVLLLVILIPVLVSSAGTSAHYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPG      1 - 70
KAGPRGPPGEPGPPGPMGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGY     71 - 140
EVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNY    141 - 210
DYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD                             211 - 255
//

Text Mined References (6)

PMID Year Title
21378161 2011 Metabolic regulation by C1q/TNF-related protein-13 (CTRP13): activation OF AMP-activated protein kinase and suppression of fatty acid-induced JNK signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10862616 2000 Conformational requirements of collagenous peptides for recognition by the chaperone protein HSP47.