Property Summary

NCBI Gene PubMed Count 7
PubMed Score 15.82
PubTator Score 13.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

Gene RIF (3)

AA Sequence

MVLLLVILIPVLVSSAGTSAHYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPG      1 - 70
KAGPRGPPGEPGPPGPMGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGY     71 - 140
EVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNY    141 - 210
DYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD                             211 - 255
//

Text Mined References (8)

PMID Year Title