Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.16
PubTator Score 2.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Rheumatoid Arthritis 2.500 0.013
astrocytic glioma 1.100 0.024
permanent atrial fibrillation -1.100 0.005
osteosarcoma -1.056 0.000
group 4 medulloblastoma 2.200 0.001
glioblastoma -1.300 0.002
medulloblastoma, large-cell -1.400 0.000
ulcerative colitis -1.117 0.008
acute quadriplegic myopathy 1.949 0.000
juvenile dermatomyositis 1.258 0.000
lung cancer -1.600 0.048
sarcoidosis 1.100 0.010
adult high grade glioma -1.300 0.001
subependymal giant cell astrocytoma -1.596 0.036
psoriasis -1.200 0.000
spina bifida -1.328 0.040
Alzheimer's disease 1.100 0.016
Pick disease 1.400 0.000
progressive supranuclear palsy 1.100 0.005
Breast cancer -1.100 0.000
ovarian cancer 2.400 0.000
dermatomyositis 1.400 0.000

Gene RIF (4)

PMID Text
26362536 HIV-1 Gag interacts with RSBN1 as demonstrated by proximity dependent biotinylation proteomics
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19565500 Observational study of gene-disease association. (HuGE Navigator)
18305142 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFISGRRTADKWRAEERLQCPAGSARAALARCADGGAVGPFKCVFVGEMAAQVGAVRVVRAVAAQEEPDK      1 - 70
EGKEKPHAGVSPRGVKRQRRSSSGGSQEKRGRPSQEPPLAPPHRRRRSRQHPGPLPPTNAAPTVPGPVEP     71 - 140
LLLPPPPPPSLAPAGPAVAAPLPAPSTSALFTFSPLTVSAAGPKHKGHKERHKHHHHRGPDGDPSSCGTD    141 - 210
LKHKDKQENGERTGGVPLIKAPKRETPDENGKTQRADDFVLKKIKKKKKKKHREDMRGRRLKMYNKEVQT    211 - 280
VCAGLTRISKEILTQGQINSTSGLNKESFRYLKDEQLCRLNLGMQEYRVPQGVQTPFMTHQEHSIRRNFL    281 - 350
KTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLALTFSENEKNAAYYALAIVHGAAA    351 - 420
YLPDFLDYFAFNFPNTPVKMEILGKKDIETTTISNFHTQVNRTYCCGTYRAGPMRQISLVGAVDEEVGDY    421 - 490
FPEFLDMLEESPFLKMTLPWGTLSSLRLQCRSQSDDGPIMWVRPGEQMIPTADMPKSPFKRRRSMNEIKN    491 - 560
LQYLPRTSEPREVLFEDRTRAHADHVGQGFDWQSTAAVGVLKAVQFGEWSDQPRITKDVICFHAEDFTDV    561 - 630
VQRLQLDLHEPPVSQCVQWVDEAKLNQMRREGIRYARIQLCDNDIYFIPRNVIHQFKTVSAVCSLAWHIR    631 - 700
LKQYHPVVEATQNTESNSNMDCGLTGKRELEVDSQCVRIKTESEEACTEIQLLTTASSSFPPASELNLQQ    701 - 770
DQKTQPIPVLKVESRLDSDQQHNLQEHSTTSV                                          771 - 802
//

Text Mined References (15)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22493691 2012 Novel associations for hypothyroidism include known autoimmune risk loci.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19565500 2009 Variants in TNFAIP3, STAT4, and C12orf30 loci associated with multiple autoimmune diseases are also associated with juvenile idiopathic arthritis.
18305142 2008 PTPN22 Trp620 explains the association of chromosome 1p13 with type 1 diabetes and shows a statistical interaction with HLA class II genotypes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...