Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.50
PubTator Score 2.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Rheumatoid arthritis 2.100 1.5e-03
acute quadriplegic myopathy 1.021 1.6e-07
adult high grade glioma -1.300 9.9e-04
Alzheimer's disease 1.100 1.6e-02
astrocytic glioma 1.100 2.4e-02
Breast cancer -1.100 2.9e-09
dermatomyositis 1.400 2.1e-04
glioblastoma -1.300 2.4e-03
group 3 medulloblastoma 1.300 3.4e-02
juvenile dermatomyositis 1.258 3.0e-08
lung cancer -1.600 4.8e-02
medulloblastoma, large-cell -1.400 3.4e-04
osteosarcoma -1.056 2.9e-05
ovarian cancer -1.500 1.4e-05
permanent atrial fibrillation -1.100 5.5e-03
Pick disease 1.400 1.1e-08
progressive supranuclear palsy 1.100 5.3e-03
psoriasis -1.100 3.6e-10
sarcoidosis 1.100 1.0e-02
spina bifida -1.328 4.0e-02
subependymal giant cell astrocytoma -1.596 3.6e-02
ulcerative colitis -1.117 8.4e-03

Gene RIF (4)

AA Sequence

MFISGRRTADKWRAEERLQCPAGSARAALARCADGGAVGPFKCVFVGEMAAQVGAVRVVRAVAAQEEPDK      1 - 70
EGKEKPHAGVSPRGVKRQRRSSSGGSQEKRGRPSQEPPLAPPHRRRRSRQHPGPLPPTNAAPTVPGPVEP     71 - 140
LLLPPPPPPSLAPAGPAVAAPLPAPSTSALFTFSPLTVSAAGPKHKGHKERHKHHHHRGPDGDPSSCGTD    141 - 210
LKHKDKQENGERTGGVPLIKAPKRETPDENGKTQRADDFVLKKIKKKKKKKHREDMRGRRLKMYNKEVQT    211 - 280
VCAGLTRISKEILTQGQINSTSGLNKESFRYLKDEQLCRLNLGMQEYRVPQGVQTPFMTHQEHSIRRNFL    281 - 350
KTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLALTFSENEKNAAYYALAIVHGAAA    351 - 420
YLPDFLDYFAFNFPNTPVKMEILGKKDIETTTISNFHTQVNRTYCCGTYRAGPMRQISLVGAVDEEVGDY    421 - 490
FPEFLDMLEESPFLKMTLPWGTLSSLRLQCRSQSDDGPIMWVRPGEQMIPTADMPKSPFKRRRSMNEIKN    491 - 560
LQYLPRTSEPREVLFEDRTRAHADHVGQGFDWQSTAAVGVLKAVQFGEWSDQPRITKDVICFHAEDFTDV    561 - 630
VQRLQLDLHEPPVSQCVQWVDEAKLNQMRREGIRYARIQLCDNDIYFIPRNVIHQFKTVSAVCSLAWHIR    631 - 700
LKQYHPVVEATQNTESNSNMDCGLTGKRELEVDSQCVRIKTESEEACTEIQLLTTASSSFPPASELNLQQ    701 - 770
DQKTQPIPVLKVESRLDSDQQHNLQEHSTTSV                                          771 - 802
//

Text Mined References (16)

PMID Year Title