Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.03
PubTator Score 2.66

Knowledge Summary

Patent (956)

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.4e-07
glioblastoma 1.100 1.2e-04
group 3 medulloblastoma 1.100 8.8e-04
medulloblastoma, large-cell -1.200 2.2e-04
osteosarcoma -1.743 6.2e-05
ovarian cancer -1.200 2.2e-04
psoriasis 1.100 1.9e-03

Protein-protein Interaction (5)

Gene RIF (3)

AA Sequence

MAALAPVGSPASRGPRLAAGLRLLPMLGLLQLLAEPGLGRVHHLALKDDVRHKVHLNTFGFFKDGYMVVN      1 - 70
VSSLSLNEPEDKDVTIGFSLDRTKNDGFSSYLDEDVNYCILKKQSVSVTLLILDISRSEVRVKSPPEAGT     71 - 140
QLPKIIFSRDEKVLGQSQEPNVNPASAGNQTQKTQDGGKSKRSTVDSKAMGEKSFSVHNNGGAVSFQFFF    141 - 210
NISTDDQEGLYSLYFHKCLGKELPSDKFTFSLDIEITEKNPDSYLSAGEIPLPKLYISMAFFFFLSGTIW    211 - 280
IHILRKRRNDVFKIHWLMAALPFTKSLSLVFHAIDYHYISSQGFPIEGWAVVYYITHLLKGALLFITIAL    281 - 350
IGTGWAFIKHILSDKDKKIFMIVIPLQVLANVAYIIIESTEEGTTEYGLWKDSLFLVDLLCCGAILFPVV    351 - 420
WSIRHLQEASATDGKGDSMGPLQQRANLRAGSRIESHHFAQADLELLASSCPPASVSQRAGITAAINLAK    421 - 490
LKLFRHYYVLIVCYIYFTRIIAFLLKLAVPFQWKWLYQLLDETATLVFFVLTGYKFRPASDNPYLQLSQE    491 - 560
EEDLEMESVVTTSGVMESMKKVKKVTNGSVEPQGEWEGAV                                  561 - 600
//

Text Mined References (11)

PMID Year Title