Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.03
PubTator Score 2.66

Knowledge Summary

Patent (956)


  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.39369204325776E-7
group 4 medulloblastoma 1875 1.67922274366696E-6
osteosarcoma 7933 6.23801102060206E-5
glioblastoma 5572 1.20664638405182E-4
medulloblastoma, large-cell 6234 2.16993419635821E-4
ovarian cancer 8492 2.21466807036852E-4
psoriasis 6685 5.10557089223465E-4


  Differential Expression (7)

Disease log2 FC p
psoriasis -1.300 0.001
osteosarcoma -1.743 0.000
group 4 medulloblastoma 1.400 0.000
atypical teratoid / rhabdoid tumor 1.100 0.000
glioblastoma 1.100 0.000
medulloblastoma, large-cell -1.200 0.000
ovarian cancer -1.200 0.000


Accession Q5VW38 A6NJ53 Q2TB81 Q5JPA3 Q5VW39 Q96T26 Q9H658 Q9HCE8
Symbols GCDRP


PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid

  TechDev Info (2)

Jing-Ruey Yeh gRNA validated for zebrafish model, zebrafish mutant available
Steve Finkbeiner Neurite and survival phenotype identified

Pathway (1)

Gene RIF (3)

25031321 The N-terminal region of GPR107 is critical for its biological function. GPR107 might be one of the long-sought receptors that associates with G-proteins to regulate intracellular vesicular transport
22933024 GPR107 is a promising candidate receptor for neuronostatin, and neuronostatin, interacting with GPR107, may play an important role in the central control of cardiovascular function.
17454009 The 18-exon human GPR107 gene is located at 9q34.2-3 and spans 86.4 kb and the cDNA encodes a 552 residue protein; murine Gpr108 cDNA encodes a 562 residue protein that has 49% identity to human GPR107.

AA Sequence

EEDLEMESVVTTSGVMESMKKVKKVTNGSVEPQGEWEGAV                                  561 - 600

Text Mined References (11)

PMID Year Title
25031321 2014 GPR107, a G-protein-coupled receptor essential for intoxication by Pseudomonas aeruginosa exotoxin A, localizes to the Golgi and is cleaved by furin.
22933024 2012 Evidence for an interaction of neuronostatin with the orphan G protein-coupled receptor, GPR107.
21269460 2011 Initial characterization of the human central proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17454009 2007 Human GPR107 and murine Gpr108 are members of the LUSTR family of proteins found in both plants and animals, having similar topology to G-protein coupled receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.