Property Summary

NCBI Gene PubMed Count 8
PubMed Score 21.29
PubTator Score 6.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Sjogren's syndrome 23
Disease Target Count P-value
atypical teratoid/rhabdoid tumor 1095 7.90118147004754E-7
posterior fossa group B ependymoma 1530 1.00860786123763E-6
ovarian cancer 8492 3.37097022051677E-5
group 3 medulloblastoma 2254 5.3374928669953E-5
medulloblastoma, large-cell 6234 0.00208603108949245
primitive neuroectodermal tumor 3031 0.00513832505522047
cystic fibrosis and chronic rhinosinusitis 213 0.0228046628918702
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.041814919271038
Disease Target Count Z-score Confidence
Quadriplegia 14 3.142 1.6

Expression

Synonym

Accession Q5VVH5 IRAK1-binding protein 1
Symbols AIP70
SIMPL

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
25943894 Primary human Muller glia cells treated with both HIV-1 clade B and clade C Tat upregulate the expression of interleukin-1 receptor-associated kinase 1 binding protein 1
17079333 Together, these studies reveal that phosphorylation of the SIMPL protein plays a critical role in SIMPL regulation by affecting both SIMPL subcellular localization and the p65 coactivator function of SIMPL.

AA Sequence

MSLQKTPPTRVFVELVPWADRSRENNLASGRETLPGLRHPLSSTQAQTATREVQVSGTSEVSAGPDRAQV      1 - 70
VVRVSSTKEAAAEAKKSVCRRLDYITQSLQQQGVQAENITVTKDFRRVENAYHMEAEVCITFTEFGKMQN     71 - 140
ICNFLVEKLDSSVVISPPQFYHTPGSVENLRRQACLVAVENAWRKAQEVCNLVGQTLGKPLLIKEEETKE    141 - 210
WEGQIDDHQSSRLSSSLTVQQKIKSATIHAASKVFITFEVKGKEKRKKHL                        211 - 260
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24165912 2013 Genome-wide association study identifies 8 novel loci associated with blood pressure responses to interventions in Han Chinese.
17079333 2007 Phosphorylation of SIMPL modulates RelA-associated NF-kappaB-dependent transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485901 2004 Tumor necrosis factor alpha induction of NF-kappaB requires the novel coactivator SIMPL.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11096118 2001 SIMPL is a tumor necrosis factor-specific regulator of nuclear factor-kappaB activity.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.