Property Summary

NCBI Gene PubMed Count 8
PubMed Score 24.36
PubTator Score 6.24

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Gene RIF (2)

AA Sequence

MSLQKTPPTRVFVELVPWADRSRENNLASGRETLPGLRHPLSSTQAQTATREVQVSGTSEVSAGPDRAQV      1 - 70
VVRVSSTKEAAAEAKKSVCRRLDYITQSLQQQGVQAENITVTKDFRRVENAYHMEAEVCITFTEFGKMQN     71 - 140
ICNFLVEKLDSSVVISPPQFYHTPGSVENLRRQACLVAVENAWRKAQEVCNLVGQTLGKPLLIKEEETKE    141 - 210
WEGQIDDHQSSRLSSSLTVQQKIKSATIHAASKVFITFEVKGKEKRKKHL                        211 - 260
//

Text Mined References (10)

PMID Year Title