Property Summary

NCBI Gene PubMed Count 8
Grant Count 13
R01 Count 4
Funding $3,694,661.03
PubMed Score 21.29
PubTator Score 6.24

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
25943894 Primary human Muller glia cells treated with both HIV-1 clade B and clade C Tat upregulate the expression of interleukin-1 receptor-associated kinase 1 binding protein 1
17079333 Together, these studies reveal that phosphorylation of the SIMPL protein plays a critical role in SIMPL regulation by affecting both SIMPL subcellular localization and the p65 coactivator function of SIMPL.

AA Sequence

MSLQKTPPTRVFVELVPWADRSRENNLASGRETLPGLRHPLSSTQAQTATREVQVSGTSEVSAGPDRAQV      1 - 70
VVRVSSTKEAAAEAKKSVCRRLDYITQSLQQQGVQAENITVTKDFRRVENAYHMEAEVCITFTEFGKMQN     71 - 140
ICNFLVEKLDSSVVISPPQFYHTPGSVENLRRQACLVAVENAWRKAQEVCNLVGQTLGKPLLIKEEETKE    141 - 210
WEGQIDDHQSSRLSSSLTVQQKIKSATIHAASKVFITFEVKGKEKRKKHL                        211 - 260
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24165912 2013 Genome-wide association study identifies 8 novel loci associated with blood pressure responses to interventions in Han Chinese.
17079333 2007 Phosphorylation of SIMPL modulates RelA-associated NF-kappaB-dependent transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485901 2004 Tumor necrosis factor alpha induction of NF-kappaB requires the novel coactivator SIMPL.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11096118 2001 SIMPL is a tumor necrosis factor-specific regulator of nuclear factor-kappaB activity.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.