Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Nephrosis 21 0.0 0.9
Disease Target Count Z-score Confidence
Sezary's disease 15 3.601 1.8

Expression

AA Sequence

MALQVRVAPSKVVLQKFLLCVILFYTVYYVSLSMGCVMFEVHELNVLAPFDFKTNPSWLNINYKVLLVST      1 - 70
EVTYFVCGLFFVPVVEEWVWDYAISVTILHVAITSTVMLEFPLTSHWWAALGISKLLV                 71 - 128
//

Text Mined References (1)

PMID Year Title