Property Summary

NCBI Gene PubMed Count 15
PubMed Score 232.28
PubTator Score 5.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma 1.700 1.4e-10
malignant mesothelioma 1.600 6.4e-06
osteosarcoma 1.002 1.7e-04
psoriasis 1.400 8.1e-04

Protein-protein Interaction (7)

Gene RIF (4)

AA Sequence

MAQRHSDSSLEEKLLGHRFHSELRLDAGGNPASGLPMVRGSPRVRDDAAFQPQVPAPPQPRPPGHEEPWP      1 - 70
IVLSTESPAALKLGTQQLIPKSLAVASKAKTPARHQSFGAAVLSREAARRDPKLLPAPSFSLDDMDVDKD     71 - 140
PGGMLRRNLRNQSYRAAMKGLGKPGGQGDAIQLSPKLQALAEEPSQPHTRSPAKNKKTLGRKRGHKGSFK    141 - 210
DDPQLYQEIQERGLNTSQESDDDILDESSSPEGTQKVDATIVVKSYRPAQVTWSQLPEVVELGILDQLST    211 - 280
EERKRQEAMFEILTSEFSYQHSLSILVEEFLQSKELRATVTQMEHHHLFSNILDVLGASQRFFEDLEQRH    281 - 350
KAQVLVEDISDILEEHAEKHFHPYIAYCSNEVYQQRTLQKLISSNAAFREALREIERRPACGGLPMLSFL    351 - 420
ILPMQRVTRLPLLMDTLCLKTQGHSERYKAASRALKAISKLVRQCNEGAHRMERMEQMYTLHTQLDFSKV    421 - 490
KSLPLISASRWLLKRGELFLVEETGLFRKIASRPTCYLFLFNDVLVVTKKKSEESYMVQDYAQMNHIQVE    491 - 560
KIEPSELPLPGGGNRSSSVPHPFQVTLLRNSEGRQEQLLLSSDSASDRARWIVALTHSERQWQGLSSKGD    561 - 630
LPQVEITKAFFAKQADEVTLQQADVVLVLQQEDGWLYGERLRDGETGWFPEDFARFITSRVAVEGNVRRM    631 - 700
ERLRVETDV                                                                 701 - 709
//

Text Mined References (21)

PMID Year Title