Property Summary

NCBI Gene PubMed Count 15
Grant Count 9
Funding $1,314,680.47
PubMed Score 205.56
PubTator Score 5.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
psoriasis 1.400 0.001
osteosarcoma 1.002 0.000
lung adenocarcinoma 1.700 0.000

Gene RIF (4)

PMID Text
21139582 These data suggest that HPV16 E6, Tip-1 and ARHGEF16 may cooperate to activate Cdc42 and support a potential link between the expression of HPV16 E6 and Cdc42 activation
20679435 The ephexin4 protein mediates cell migration through a RhoG-dependent mechanism.
19911011 Observational study of gene-disease association. (HuGE Navigator)
19707205 Sixty-four novel structural analogues of Y27632 were synthesized and tested for their ability to persistently inhibit the transformation of NIH3T3 cells by Rho guanidine exchange factor 16 (ARHGEF16) or Ras.

AA Sequence

MAQRHSDSSLEEKLLGHRFHSELRLDAGGNPASGLPMVRGSPRVRDDAAFQPQVPAPPQPRPPGHEEPWP      1 - 70
IVLSTESPAALKLGTQQLIPKSLAVASKAKTPARHQSFGAAVLSREAARRDPKLLPAPSFSLDDMDVDKD     71 - 140
PGGMLRRNLRNQSYRAAMKGLGKPGGQGDAIQLSPKLQALAEEPSQPHTRSPAKNKKTLGRKRGHKGSFK    141 - 210
DDPQLYQEIQERGLNTSQESDDDILDESSSPEGTQKVDATIVVKSYRPAQVTWSQLPEVVELGILDQLST    211 - 280
EERKRQEAMFEILTSEFSYQHSLSILVEEFLQSKELRATVTQMEHHHLFSNILDVLGASQRFFEDLEQRH    281 - 350
KAQVLVEDISDILEEHAEKHFHPYIAYCSNEVYQQRTLQKLISSNAAFREALREIERRPACGGLPMLSFL    351 - 420
ILPMQRVTRLPLLMDTLCLKTQGHSERYKAASRALKAISKLVRQCNEGAHRMERMEQMYTLHTQLDFSKV    421 - 490
KSLPLISASRWLLKRGELFLVEETGLFRKIASRPTCYLFLFNDVLVVTKKKSEESYMVQDYAQMNHIQVE    491 - 560
KIEPSELPLPGGGNRSSSVPHPFQVTLLRNSEGRQEQLLLSSDSASDRARWIVALTHSERQWQGLSSKGD    561 - 630
LPQVEITKAFFAKQADEVTLQQADVVLVLQQEDGWLYGERLRDGETGWFPEDFARFITSRVAVEGNVRRM    631 - 700
ERLRVETDV                                                                 701 - 709
//

Text Mined References (21)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21139582 2011 The HPV16 E6 binding protein Tip-1 interacts with ARHGEF16, which activates Cdc42.
20679435 2010 Ephexin4 and EphA2 mediate cell migration through a RhoG-dependent mechanism.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
19707205 2009 Analogues of Y27632 increase gap junction communication and suppress the formation of transformed NIH3T3 colonies.
More...