Knowledge Summary

Patent

No data available

Synonym

Accession Q5VV11
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MRKLRLRASNPGPSGAPGTRQHFSTSRGGHHCARRWLRRVRRSRSQTPSYQNLDPNPPIVRFPLPLERIS      1 - 70
EVPRRACLHGRDASSVWPPPERSD                                                   71 - 94
//

Text Mined References (1)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.