Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
interstitial cystitis 2299 0.00504765091461285
osteosarcoma 7933 0.00726217918543343
astrocytic glioma 2241 0.0100724753965501
oligodendroglioma 2849 0.0393968876995876
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 192 0.0 2.0
Disease Target Count Z-score Confidence
Neuromuscular disease 3 3.033 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.800 0.010
oligodendroglioma -1.300 0.039
osteosarcoma 1.277 0.007
interstitial cystitis -1.200 0.005

Synonym

Accession Q5VUM1 E1P532 SDH assembly factor 4
Symbols Sdh8
C6orf57

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTPSRLPWLLSWVSATAWRAARSPLLCHSLRKTSSSQGGKSELVKQSLKKPKLPEGRFDAPEDSHLEKEP      1 - 70
LEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF                                     71 - 108
//

Text Mined References (7)

PMID Year Title
24954416 2014 SDHAF4 promotes mitochondrial succinate dehydrogenase activity and prevents neurodegeneration.
21490949 2011 Transferability of type 2 diabetes implicated loci in multi-ethnic cohorts from Southeast Asia.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.