Property Summary

NCBI Gene PubMed Count 7
Grant Count 8
R01 Count 8
Funding $995,492.5
PubMed Score 2.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.800 0.010
oligodendroglioma -1.300 0.039
osteosarcoma 1.277 0.007
interstitial cystitis -1.200 0.005

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTPSRLPWLLSWVSATAWRAARSPLLCHSLRKTSSSQGGKSELVKQSLKKPKLPEGRFDAPEDSHLEKEP      1 - 70
LEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF                                     71 - 108
//

Text Mined References (7)

PMID Year Title
24954416 2014 SDHAF4 promotes mitochondrial succinate dehydrogenase activity and prevents neurodegeneration.
21490949 2011 Transferability of type 2 diabetes implicated loci in multi-ethnic cohorts from Southeast Asia.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.