Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 5.78767326341807E-11
psoriasis 6685 5.87834181106333E-10
ovarian cancer 8492 4.84756394184995E-4
adrenocortical adenoma 134 0.0053525797613176
pilocytic astrocytoma 3086 0.005744323419189
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0106527271387499
medulloblastoma 1524 0.0154685216916235
subependymal giant cell astrocytoma 2287 0.0180641024233139
Disease Target Count Z-score Confidence
Asthma 349 0.0 2.0
Narcolepsy 69 0.0 2.0

Expression

  Differential Expression (8)

AA Sequence

MAARQIWARTGAALCRQPSAAPPPAPLWVRAGFRQQLSLTLCPANEGNCGGSAPSTPGRPERAARPSVSE      1 - 70
ELTAAERQIAELHAAACAAGQLNYVDPATGYVVLTQIAHLQRGECCGSACRHCPYGQVNVKDPSKKKQFN     71 - 140
SYFYV                                                                     141 - 145
//

Text Mined References (6)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15897902 2005 KIF14 is a candidate oncogene in the 1q minimal region of genomic gain in multiple cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.