Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical adenoma -1.042 5.4e-03
Astrocytoma, Pilocytic -1.200 5.6e-03
ependymoma -1.600 5.0e-04
group 4 medulloblastoma -1.600 7.1e-03
intraductal papillary-mucinous neoplasm ... 1.800 1.1e-02
ovarian cancer -1.300 1.6e-03
psoriasis 1.100 5.9e-10
subependymal giant cell astrocytoma 1.939 1.8e-02

AA Sequence

MAARQIWARTGAALCRQPSAAPPPAPLWVRAGFRQQLSLTLCPANEGNCGGSAPSTPGRPERAARPSVSE      1 - 70
ELTAAERQIAELHAAACAAGQLNYVDPATGYVVLTQIAHLQRGECCGSACRHCPYGQVNVKDPSKKKQFN     71 - 140
SYFYV                                                                     141 - 145
//

Text Mined References (6)

PMID Year Title