Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.02
PubTator Score 0.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical carcinoma 1.690 2.3e-03
adult high grade glioma -1.300 3.1e-04
Astrocytoma, Pilocytic -1.100 1.9e-05
atypical teratoid / rhabdoid tumor -1.400 3.3e-05
Barrett's esophagus 1.400 1.8e-02
Breast cancer -1.900 6.7e-05
breast carcinoma -1.200 4.6e-06
esophageal adenocarcinoma 1.400 2.9e-02
glioblastoma -1.500 3.6e-02
invasive ductal carcinoma -1.900 1.0e-04
lung cancer 1.800 6.8e-04
malignant mesothelioma -1.200 2.8e-06
ovarian cancer 1.100 4.3e-04
pituitary cancer 2.200 1.3e-09
psoriasis -1.800 1.1e-04
subependymal giant cell astrocytoma -2.721 3.1e-02

Gene RIF (1)

AA Sequence

MSRSATLLLCLLGCHVWKAVTKTLREPGAGAQEVTLKVHISDASTHQPVADALIEIFTNQASIASGTSGT      1 - 70
DGVAFIKFQYKLGSQLIVTASKHAYVPNSAPWKPIRLPVFSSLSLGLLPERSATLMVYEDVVQIVSGFQG     71 - 140
ARPQPRVHFQRRALRLPENTSYSDLTAFLTAASSPSEVDSFPYLRGLDGNGTGNSTRHDLTPVTAVSVHL    141 - 210
LSSNGTPVLVDGPIYVTVPLATQSSLRHNAYVAAWRFDQKLGTWLKSGLGLVHQEGSQLTWTYIAPQLGY    211 - 280
WVAAMSPPIPGPVVTQDITTYHTVFLLAILGGMAFILLVLLCLLLYYCRRKCLKPRQHHRKLQLPAGLES    281 - 350
SKRDQSTSMSHINLLFSRRASEFPGPLSVTSHGRPEAPGTKELMSGVHLEMMSPGGEGDLHTPMLKLSYS    351 - 420
TSQEFSSREELLSCKEEDKSQISFDNLTPSGTLGKDYHKSVEVFPLKARKSMEREGYESSGNDDYRGSYN    421 - 490
TVLSQPLFEKQDREGPASTGSKLTIQEHLYPAPSSPEKEQLLDRRPTECMMSRSVDHLERPTSFPRPGQL    491 - 560
ICCSSVDQVNDSVYRKVLPALVIPAHYMKLPGDHSYVSQPLVVPADQQLEIERLQAELSNPHAGIFPHPS    561 - 630
SQIQPQPLSSQAISQQHLQDAGTREWSPQNASMSESLSIPASLNDAALAQMNSEVQLLTEKALMELGGGK    631 - 700
PLPHPRAWFVSLDGRSNAHVRHSYIDLQRAGRNGSNDASLDSGVDMNEPKSARKGRGDALSLQQNYPPVQ    701 - 770
EHQQKEPRAPDSTAYTQLVYLDDVEQSGSECGTTVCTPEDSALRCLLEGSSRRSGGQLPSLQEETTRRTA    771 - 840
DAPSEPAASPHQRRSAHEEEEDDDDDDQGEDKKSPWQKREERPLMAFNIK                        841 - 890
//

Text Mined References (11)

PMID Year Title