Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.02
PubTator Score 0.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
pituitary cancer 1972 1.32241857401974E-9
malignant mesothelioma 3163 2.80282959888269E-6
breast carcinoma 1614 4.64155286372976E-6
pilocytic astrocytoma 3086 1.55340926234661E-5
atypical teratoid / rhabdoid tumor 4369 3.28929535201961E-5
Breast cancer 3099 6.70232029744468E-5
invasive ductal carcinoma 2950 1.04995397592415E-4
psoriasis 6685 1.09099495907815E-4
ovarian cancer 8492 1.77638689736641E-4
adult high grade glioma 2148 3.07035712056239E-4
lung cancer 4473 6.76841183698981E-4
adrenocortical carcinoma 1427 0.00225919075928746
Barrett's esophagus 185 0.0179149872335323
esophageal adenocarcinoma 737 0.0291576802181821
subependymal giant cell astrocytoma 2287 0.0312670485817834
glioblastoma 5572 0.0359901383811202
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
Barrett's esophagus 1.400 0.018
esophageal adenocarcinoma 1.400 0.029
psoriasis -1.800 0.000
glioblastoma -1.500 0.036
atypical teratoid / rhabdoid tumor -1.400 0.000
adrenocortical carcinoma 1.690 0.002
lung cancer 1.800 0.001
breast carcinoma -1.200 0.000
adult high grade glioma -1.300 0.000
pilocytic astrocytoma -1.100 0.000
subependymal giant cell astrocytoma -2.721 0.031
Breast cancer -1.900 0.000
invasive ductal carcinoma -1.900 0.000
ovarian cancer 1.300 0.000
pituitary cancer 2.200 0.000

Synonym

Accession Q5VUB5 D3DRT9 Q32M49 Q8N4I0
Symbols C10orf38

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSRSATLLLCLLGCHVWKAVTKTLREPGAGAQEVTLKVHISDASTHQPVADALIEIFTNQASIASGTSGT      1 - 70
DGVAFIKFQYKLGSQLIVTASKHAYVPNSAPWKPIRLPVFSSLSLGLLPERSATLMVYEDVVQIVSGFQG     71 - 140
ARPQPRVHFQRRALRLPENTSYSDLTAFLTAASSPSEVDSFPYLRGLDGNGTGNSTRHDLTPVTAVSVHL    141 - 210
LSSNGTPVLVDGPIYVTVPLATQSSLRHNAYVAAWRFDQKLGTWLKSGLGLVHQEGSQLTWTYIAPQLGY    211 - 280
WVAAMSPPIPGPVVTQDITTYHTVFLLAILGGMAFILLVLLCLLLYYCRRKCLKPRQHHRKLQLPAGLES    281 - 350
SKRDQSTSMSHINLLFSRRASEFPGPLSVTSHGRPEAPGTKELMSGVHLEMMSPGGEGDLHTPMLKLSYS    351 - 420
TSQEFSSREELLSCKEEDKSQISFDNLTPSGTLGKDYHKSVEVFPLKARKSMEREGYESSGNDDYRGSYN    421 - 490
TVLSQPLFEKQDREGPASTGSKLTIQEHLYPAPSSPEKEQLLDRRPTECMMSRSVDHLERPTSFPRPGQL    491 - 560
ICCSSVDQVNDSVYRKVLPALVIPAHYMKLPGDHSYVSQPLVVPADQQLEIERLQAELSNPHAGIFPHPS    561 - 630
SQIQPQPLSSQAISQQHLQDAGTREWSPQNASMSESLSIPASLNDAALAQMNSEVQLLTEKALMELGGGK    631 - 700
PLPHPRAWFVSLDGRSNAHVRHSYIDLQRAGRNGSNDASLDSGVDMNEPKSARKGRGDALSLQQNYPPVQ    701 - 770
EHQQKEPRAPDSTAYTQLVYLDDVEQSGSECGTTVCTPEDSALRCLLEGSSRRSGGQLPSLQEETTRRTA    771 - 840
DAPSEPAASPHQRRSAHEEEEDDDDDDQGEDKKSPWQKREERPLMAFNIK                        841 - 890
//

Text Mined References (11)

PMID Year Title
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...