Property Summary

NCBI Gene PubMed Count 25
PubMed Score 24.69
PubTator Score 9.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non-small cell lung cancer 2890 1.0e-12
glioblastoma 5792 2.0e-10
Astrocytoma, Pilocytic 3081 6.2e-10
psoriasis 6694 1.3e-08
ovarian cancer 8520 9.1e-08
malignant mesothelioma 3232 3.0e-07
Amyotrophic lateral sclerosis 451 3.0e-06
adult high grade glioma 3801 8.3e-06
group 3 medulloblastoma 4104 9.5e-06
primitive neuroectodermal tumor 3035 2.0e-05
osteosarcoma 7950 2.6e-05
atypical teratoid / rhabdoid tumor 5112 4.4e-05
acute quadriplegic myopathy 1158 2.9e-04
medulloblastoma, large-cell 6241 4.0e-04
hepatocellular carcinoma 547 6.0e-04
lung cancer 4740 8.9e-04
interstitial cystitis 2312 1.1e-03
Down syndrome 499 1.7e-03
pituitary cancer 1972 2.2e-03
Pick disease 1894 3.7e-03
intraductal papillary-mucinous adenoma (IPMA) 2955 4.6e-03
oligodendroglioma 2850 5.0e-03
intraductal papillary-mucinous carcinoma (IPMC) 2989 5.1e-03
pancreatic carcinoma 562 5.1e-03
pancreatic cancer 2398 5.1e-03
chronic rhinosinusitis 512 5.4e-03
progressive supranuclear palsy 676 7.7e-03
tuberculosis 2010 1.0e-02
cystic fibrosis and chronic rhinosinusitis 214 1.5e-02
gastric cancer 459 1.8e-02
esophageal adenocarcinoma 737 1.9e-02
ependymoma 4679 2.0e-02
pancreatic ductal adenocarcinoma liver metastasis 1962 2.1e-02
invasive ductal carcinoma 2951 2.2e-02
Parkinson's disease 392 2.6e-02
Waldenstrons macroglobulinemia 765 2.7e-02
subependymal giant cell astrocytoma 2287 2.8e-02
astrocytic glioma 2597 3.2e-02
hereditary spastic paraplegia 318 4.6e-02
Breast cancer 3578 4.9e-02

Expression

  Differential Expression (40)

Disease log2 FC p
Breast cancer 2.800 4.9e-02
acute quadriplegic myopathy 1.071 2.9e-04
adult high grade glioma -1.800 8.3e-06
Amyotrophic lateral sclerosis 1.042 3.0e-06
astrocytic glioma 2.300 3.2e-02
Astrocytoma, Pilocytic -1.900 6.2e-10
atypical teratoid / rhabdoid tumor -1.900 4.4e-05
chronic rhinosinusitis -1.242 5.4e-03
cystic fibrosis and chronic rhinosinusit... -1.133 1.5e-02
Down syndrome 1.400 1.7e-03
ependymoma 2.400 2.0e-02
esophageal adenocarcinoma 1.100 1.9e-02
gastric cancer 1.100 1.8e-02
glioblastoma -1.800 2.0e-10
group 3 medulloblastoma -2.300 9.5e-06
hepatocellular carcinoma 1.200 6.0e-04
hereditary spastic paraplegia -1.249 4.6e-02
interstitial cystitis 1.100 1.1e-03
intraductal papillary-mucinous adenoma (... 1.700 4.6e-03
intraductal papillary-mucinous carcinoma... 1.500 5.1e-03
invasive ductal carcinoma -1.300 2.2e-02
lung cancer -1.900 8.9e-04
malignant mesothelioma -2.000 3.0e-07
medulloblastoma, large-cell -3.800 4.0e-04
non-small cell lung cancer -1.169 1.0e-12
oligodendroglioma 1.900 5.0e-03
osteosarcoma 1.895 2.6e-05
ovarian cancer -2.100 9.1e-08
pancreatic cancer 1.400 5.1e-03
pancreatic carcinoma 1.400 5.1e-03
pancreatic ductal adenocarcinoma liver m... -1.003 2.1e-02
Parkinson's disease 1.100 2.6e-02
Pick disease 1.300 3.7e-03
pituitary cancer 1.200 2.2e-03
primitive neuroectodermal tumor -1.900 2.0e-05
progressive supranuclear palsy 1.100 7.7e-03
psoriasis -1.800 1.3e-08
subependymal giant cell astrocytoma -1.601 2.8e-02
tuberculosis -1.100 1.0e-02
Waldenstrons macroglobulinemia -1.114 2.7e-02

 GWAS Trait (1)

Gene RIF (4)

AA Sequence

MSNGYRTLSQHLNDLKKENFSLKLRIYFLEERMQQKYEASREDIYKRNIELKVEVESLKRELQDKKQHLD      1 - 70
KTWADVENLNSQNEAELRRQFEERQQETEHVYELLENKIQLLQEESRLAKNEAARMAALVEAEKECNLEL     71 - 140
SEKLKGVTKNWEDVPGDQVKPDQYTEALAQRDKRIEELNQSLAAQERLVEQLSREKQQLLHLLEEPTSME    141 - 210
VQPMTEELLKQQKLNSHETTITQQSVSDSHLAELQEKIQQTEATNKILQEKLNEMSYELKCAQESSQKQD    211 - 280
GTIQNLKETLKSRERETEELYQVIEGQNDTMAKLREMLHQSQLGQLHSSEGTSPAQQQVALLDLQSALFC    281 - 350
SQLEIQKLQRVVRQKERQLADAKQCVQFVEAAAHESEQQKEASWKHNQELRKALQQLQEELQNKSQQLRA    351 - 420
WEAEKYNEIRTQEQNIQHLNHSLSHKEQLLQEFRELLQYRDNSDKTLEANEMLLEKLRQRIHDKAVALER    421 - 490
AIDEKFSALEEKEKELRQLRLAVRERDHDLERLRDVLSSNEATMQSMESLLRAKGLEVEQLSTTCQNLQW    491 - 560
LKEEMETKFSRWQKEQESIIQQLQTSLHDRNKEVEDLSATLLCKLGPGQSEIAEELCQRLQRKERMLQDL    561 - 630
LSDRNKQVLEHEMEIQGLLQSVSTREQESQAAAEKLVQALMERNSELQALRQYLGGRDSLMSQAPISNQQ    631 - 700
AEVTPTGCLGKQTDQGSMQIPSRDDSTSLTAKEDVSIPRSTLGDLDTVAGLEKELSNAKEELELMAKKER    701 - 770
ESQMELSALQSMMAVQEEELQVQAADMESLTRNIQIKEDLIKDLQMQLVDPEDIPAMERLTQEVLLLREK    771 - 840
VASVESQGQEISGNRRQQLLLMLEGLVDERSRLNEALQAERQLYSSLVKFHAHPESSERDRTLQVELEGA    841 - 910
QVLRSRLEEVLGRSLERLNRLETLAAIGGAAAGDDTEDTSTEFTDSIEEEAAHHSHQQLVKVALEKSLAT    911 - 980
VETQNPSFSPPSPMGGDSNRCLQEEMLHLRAEFHQHLEEKRKAEEELKELKAQIEEAGFSSVSHIRNTML    981 - 1050
SLCLENAELKEQMGEAMSDGWEIEEDKEKGEVMVETVVTKEGLSESSLQAEFRKLQGKLKNAHNIINLLK   1051 - 1120
EQLVLSSKEGNSKLTPELLVHLTSTIERINTELVGSPGKHQHQEEGNVTVRPFPRPQSLDLGATFTVDAH   1121 - 1190
QLDNQSQPRDPGPQSAFSLPGSTQHLRSQLSQCKQRYQDLQEKLLLSEATVFAQANELEKYRVMLTGESL   1191 - 1260
VKQDSKQIQVDLQDLGYETCGRSENEAEREETTSPECEEHNSLKEMVLMEGLCSEQGRRGSTLASSSERK   1261 - 1330
PLENQLGKQEEFRVYGKSENILVLRKDIKDLKAQLQNANKVIQNLKSRVRSLSVTSDYSSSLERPWKLRA   1331 - 1400
VGTLEGSSPHSVPDEDEGWLSDGTGAFYSPGLQAKKDLESLIQRVSQLEAQLPKNGLEEKLAEELRSASW   1401 - 1470
PGKYDSLIQDQARELSYLRQKIREGRGICYLITRHAKDTVKSFEDLLRSNDIDYYLGQSFREQLAQGSQL   1471 - 1540
TERLTSKLSTKDHKSEKDQAGLEPLALRLSRELQEKEKVIEVLQAKLDARSLTPSSSHALSDSHRSPSST   1541 - 1610
SFLSDELEACSDMDIVSEYTHYEEKKASPSHSDSIHHSSHSAVLSSKPSSTSASQGAKAESNSNPISLPT   1611 - 1680
PQNTPKEANQAHSGFHFHSIPKLASLPQAPLPSAPSSFLPFSPTGPLLLGCCETPVVSLAEAQQELQMLQ   1681 - 1750
KQLGESASTVPPASTATLLSNDLEADSSYYLNSAQPHSPPRGTIELGRILEPGYLGSSGKWDVMRPQKGS   1751 - 1820
VSGDLSSGSSVYQLNSKPTGADLLEEHLGEIRNLRQRLEESICINDRLREQLEHRLTSTARGRGSTSNFY   1821 - 1890
SQGLESIPQLCNENRVLREDNRRLQAQLSHVSREHSQETESLREALLSSRSHLQELEKELEHQKVERQQL   1891 - 1960
LEDLREKQQEVLHFREERLSLQENDSRLQHKLVLLQQQCEEKQQLFESLQSELQIYEALYGNSKKGLKAY   1961 - 2030
SLDACHQIPLSSDLSHLVAEVRALRGQLEQSIQGNNCLRLQLQQQLESGAGKASLSPSSINQNFPASTDP   2031 - 2100
GNKQLLLQDSAVSPPVRDVGMNSPALVFPSSASSTPGSETPIINRANGLGLDTSPVMKTPPKLEGDATDG   2101 - 2170
SFANKHGRHVIGHIDDYSALRQQIAEGKLLVKKIVSLVRSACSFPGLEAQGTEVLGSKGIHELRSSTSAL   2171 - 2240
HHALEESASLLTMFWRAALPSTHIPVLPGKVGESTERELLELRTKVSKQERLLQSTTEHLKNANQQKESM   2241 - 2310
EQFIVSQLTRTHDVLKKARTNLEVKSLRALPCTPAL                                     2311 - 2346
//

Text Mined References (35)

PMID Year Title