Property Summary

NCBI Gene PubMed Count 22
PubMed Score 24.79
PubTator Score 9.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.02207875744387E-12
medulloblastoma 1524 5.38446948591358E-12
pilocytic astrocytoma 3086 1.63514016080222E-9
malignant mesothelioma 3163 1.81698435138123E-9
psoriasis 6685 1.33376092394218E-8
ovarian cancer 8492 1.75456535136371E-7
Amyotrophic Lateral Sclerosis 432 3.02738260775541E-6
glioblastoma 5572 3.39191779689516E-6
acute quadriplegic myopathy 1157 5.84186506483058E-6
adult high grade glioma 2148 8.31612375269813E-6
tuberculosis 1563 1.31407279477903E-5
primitive neuroectodermal tumor 3031 1.97251268044549E-5
osteosarcoma 7933 2.60427841627563E-5
atypical teratoid / rhabdoid tumor 4369 4.35922222991774E-5
medulloblastoma, large-cell 6234 3.97446539852612E-4
hepatocellular carcinoma 550 5.95259936376308E-4
lung cancer 4473 8.92254764003796E-4
interstitial cystitis 2299 0.00109726260042454
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00158423861694483
Down syndrome 548 0.00166594035855235
pituitary cancer 1972 0.00224687877355643
Pick disease 1893 0.00371840953596757
oligodendroglioma 2849 0.00503097862408584
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00507331020404086
chronic rhinosinusitis 512 0.00539557439229109
pancreatic cancer 2300 0.00654203401839906
pancreatic carcinoma 567 0.00654203401839906
progressive supranuclear palsy 674 0.00767821441462425
cystic fibrosis and chronic rhinosinusitis 213 0.0149958358698674
gastric cancer 436 0.0182353167213062
esophageal adenocarcinoma 737 0.0190553920760902
ependymoma 2514 0.0195625679984833
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0213612968567851
invasive ductal carcinoma 2950 0.022198485194175
Parkinson's disease 364 0.0259740676856528
Waldenstrons macroglobulinemia 765 0.0266527175737432
subependymal giant cell astrocytoma 2287 0.0283271196439028
astrocytic glioma 2241 0.0318839091373281
hereditary spastic paraplegia 313 0.0457937236595335
Breast cancer 3099 0.0486126421680038
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

 GWAS Trait (1)

Pathway (1)

Gene RIF (4)

PMID Text
25961151 PDE4DIP genetic variation was associated with increased risk for ischemic stroke.
21767579 A role of the SANS-myomegalin complex in microtubule-dependent inner segment cargo transport towards the ciliary base of photoreceptor cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17143517 MMGL-antibody is significantly with a favorable prognosis. Consequently, MMGL-anatibodies may be a useful tumor marker to diagnose and establish a prognosis in patients with esophageal squamous cell carcinoma.

AA Sequence

MSNGYRTLSQHLNDLKKENFSLKLRIYFLEERMQQKYEASREDIYKRNIELKVEVESLKRELQDKKQHLD      1 - 70
KTWADVENLNSQNEAELRRQFEERQQETEHVYELLENKIQLLQEESRLAKNEAARMAALVEAEKECNLEL     71 - 140
SEKLKGVTKNWEDVPGDQVKPDQYTEALAQRDKRIEELNQSLAAQERLVEQLSREKQQLLHLLEEPTSME    141 - 210
VQPMTEELLKQQKLNSHETTITQQSVSDSHLAELQEKIQQTEATNKILQEKLNEMSYELKCAQESSQKQD    211 - 280
GTIQNLKETLKSRERETEELYQVIEGQNDTMAKLREMLHQSQLGQLHSSEGTSPAQQQVALLDLQSALFC    281 - 350
SQLEIQKLQRVVRQKERQLADAKQCVQFVEAAAHESEQQKEASWKHNQELRKALQQLQEELQNKSQQLRA    351 - 420
WEAEKYNEIRTQEQNIQHLNHSLSHKEQLLQEFRELLQYRDNSDKTLEANEMLLEKLRQRIHDKAVALER    421 - 490
AIDEKFSALEEKEKELRQLRLAVRERDHDLERLRDVLSSNEATMQSMESLLRAKGLEVEQLSTTCQNLQW    491 - 560
LKEEMETKFSRWQKEQESIIQQLQTSLHDRNKEVEDLSATLLCKLGPGQSEIAEELCQRLQRKERMLQDL    561 - 630
LSDRNKQVLEHEMEIQGLLQSVSTREQESQAAAEKLVQALMERNSELQALRQYLGGRDSLMSQAPISNQQ    631 - 700
AEVTPTGCLGKQTDQGSMQIPSRDDSTSLTAKEDVSIPRSTLGDLDTVAGLEKELSNAKEELELMAKKER    701 - 770
ESQMELSALQSMMAVQEEELQVQAADMESLTRNIQIKEDLIKDLQMQLVDPEDIPAMERLTQEVLLLREK    771 - 840
VASVESQGQEISGNRRQQLLLMLEGLVDERSRLNEALQAERQLYSSLVKFHAHPESSERDRTLQVELEGA    841 - 910
QVLRSRLEEVLGRSLERLNRLETLAAIGGAAAGDDTEDTSTEFTDSIEEEAAHHSHQQLVKVALEKSLAT    911 - 980
VETQNPSFSPPSPMGGDSNRCLQEEMLHLRAEFHQHLEEKRKAEEELKELKAQIEEAGFSSVSHIRNTML    981 - 1050
SLCLENAELKEQMGEAMSDGWEIEEDKEKGEVMVETVVTKEGLSESSLQAEFRKLQGKLKNAHNIINLLK   1051 - 1120
EQLVLSSKEGNSKLTPELLVHLTSTIERINTELVGSPGKHQHQEEGNVTVRPFPRPQSLDLGATFTVDAH   1121 - 1190
QLDNQSQPRDPGPQSAFSLPGSTQHLRSQLSQCKQRYQDLQEKLLLSEATVFAQANELEKYRVMLTGESL   1191 - 1260
VKQDSKQIQVDLQDLGYETCGRSENEAEREETTSPECEEHNSLKEMVLMEGLCSEQGRRGSTLASSSERK   1261 - 1330
PLENQLGKQEEFRVYGKSENILVLRKDIKDLKAQLQNANKVIQNLKSRVRSLSVTSDYSSSLERPWKLRA   1331 - 1400
VGTLEGSSPHSVPDEDEGWLSDGTGAFYSPGLQAKKDLESLIQRVSQLEAQLPKNGLEEKLAEELRSASW   1401 - 1470
PGKYDSLIQDQARELSYLRQKIREGRGICYLITRHAKDTVKSFEDLLRSNDIDYYLGQSFREQLAQGSQL   1471 - 1540
TERLTSKLSTKDHKSEKDQAGLEPLALRLSRELQEKEKVIEVLQAKLDARSLTPSSSHALSDSHRSPSST   1541 - 1610
SFLSDELEACSDMDIVSEYTHYEEKKASPSHSDSIHHSSHSAVLSSKPSSTSASQGAKAESNSNPISLPT   1611 - 1680
PQNTPKEANQAHSGFHFHSIPKLASLPQAPLPSAPSSFLPFSPTGPLLLGCCETPVVSLAEAQQELQMLQ   1681 - 1750
KQLGESASTVPPASTATLLSNDLEADSSYYLNSAQPHSPPRGTIELGRILEPGYLGSSGKWDVMRPQKGS   1751 - 1820
VSGDLSSGSSVYQLNSKPTGADLLEEHLGEIRNLRQRLEESICINDRLREQLEHRLTSTARGRGSTSNFY   1821 - 1890
SQGLESIPQLCNENRVLREDNRRLQAQLSHVSREHSQETESLREALLSSRSHLQELEKELEHQKVERQQL   1891 - 1960
LEDLREKQQEVLHFREERLSLQENDSRLQHKLVLLQQQCEEKQQLFESLQSELQIYEALYGNSKKGLKAY   1961 - 2030
SLDACHQIPLSSDLSHLVAEVRALRGQLEQSIQGNNCLRLQLQQQLESGAGKASLSPSSINQNFPASTDP   2031 - 2100
GNKQLLLQDSAVSPPVRDVGMNSPALVFPSSASSTPGSETPIINRANGLGLDTSPVMKTPPKLEGDATDG   2101 - 2170
SFANKHGRHVIGHIDDYSALRQQIAEGKLLVKKIVSLVRSACSFPGLEAQGTEVLGSKGIHELRSSTSAL   2171 - 2240
HHALEESASLLTMFWRAALPSTHIPVLPGKVGESTERELLELRTKVSKQERLLQSTTEHLKNANQQKESM   2241 - 2310
EQFIVSQLTRTHDVLKKARTNLEVKSLRALPCTPAL                                     2311 - 2346
//

Text Mined References (31)

PMID Year Title
25961151 2015 Rare and Coding Region Genetic Variants Associated With Risk of Ischemic Stroke: The NHLBI Exome Sequence Project.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22864933 2012 Identification of novel germline polymorphisms governing capecitabine sensitivity.
21767579 2011 Direct interaction of the Usher syndrome 1G protein SANS and myomegalin in the retina.
21569246 2011 Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...