Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.43
PubTator Score 1.08

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
hereditary spastic paraplegia 313 0.0327397161513254


  Differential Expression (1)

Disease log2 FC p
hereditary spastic paraplegia -1.029 0.033


  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (3)

26060189 MYOM3 fragments hold promise for minimally invasive assessment of experimental therapies for DMD and other neuromuscular disorders.
19023099 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

DSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELKSM                                    1401 - 1437

Text Mined References (10)

PMID Year Title
26060189 2015 Serum proteomic profiling reveals fragments of MYOM3 as potential biomarkers for monitoring the outcome of therapeutic interventions in muscular dystrophies.
23092984 2012 Genome-wide association of mood-incongruent psychotic bipolar disorder.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18177667 2008 Myomesin 3, a novel structural component of the M-band in striated muscle.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.