Property Summary

NCBI Gene PubMed Count 40
Grant Count 36
R01 Count 29
Funding $2,546,060.31
PubMed Score 56.40
PubTator Score 34.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
acute quadriplegic myopathy 1.519 0.000
ovarian cancer -2.200 0.000

Gene RIF (24)

PMID Text
26206755 It was observed that RE-IIBP induces MEIS1-mediated apoptosis, which was dependent on H2BK120 ubiquitination by RNF20.
24600005 Together, these results indicate that human adenovirus E1A uses hBre1 to recruit the hPaf1 complex in order to optimally activate viral early transcription by enhancing transcriptional elongation.
24357716 A primary role for FACT in RNF20 recruitment chromatin remodeling for initiation of homologous recombination repair.
23785282 The ability of E1A to target hBre1 to simultaneously repress cellular IFN dependent transcription while activating viral transcription
23412334 model whereby cotranscriptional recruitment of Rnf20 at MLL-fusion target genes leads to amplification of Dot1l-mediated H3K79 methylation, thereby rendering leukemia cells dependent on Rnf20 to maintain their oncogenic transcriptional program
23125841 Tandem affinity purification and mass spectrometry analysis identify E3 ubiquitin protein ligase ring finger protein 20 (RNF20; BRE1A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify E3 ubiquitin protein ligase ring finger protein 20 (RNF20; BRE1A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify E3 ubiquitin protein ligase ring finger protein 20 (RNF20; BRE1A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify E3 ubiquitin protein ligase ring finger protein 20 (RNF20; BRE1A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22354749 We show that Bre1 (human BRE1A/B (RNF20/40) and mouse Bre1a/b (Rnf20/40)) acts as an important suppressor of chromosomal instability
More...

AA Sequence

MSGIGNKRAAGEPGTSMPPEKKAAVEDSGTTVETIKLGGVSSTEELDIRTLQTKNRKLAEMLDQRQAIED      1 - 70
ELREHIEKLERRQATDDASLLIVNRYWSQFDENIRIILKRYDLEQGLGDLLTERKALVVPEPEPDSDSNQ     71 - 140
ERKDDRERGEGQEPAFSFLATLASSSSEEMESQLQERVESSRRAVSQIVTVYDKLQEKVELLSRKLNSGD    141 - 210
NLIVEEAVQELNSFLAQENMRLQELTDLLQEKHRTMSQEFSKLQSKVETAESRVSVLESMIDDLQWDIDK    211 - 280
IRKREQRLNRHLAEVLERVNSKGYKVYGAGSSLYGGTITINARKFEEMNAELEENKELAQNRLCELEKLR    281 - 350
QDFEEVTTQNEKLKVELRSAVEQVVKETPEYRCMQSQFSVLYNESLQLKAHLDEARTLLHGTRGTHQHQV    351 - 420
ELIERDEVSLHKKLRTEVIQLEDTLAQVRKEYEMLRIEFEQTLAANEQAGPINREMRHLISSLQNHNHQL    421 - 490
KGEVLRYKRKLREAQSDLNKTRLRSGSALLQSQSSTEDPKDEPAELKPDSEDLSSQSSASKASQEDANEI    491 - 560
KSKRDEEERERERREKEREREREREKEKEREREKQKLKESEKERDSAKDKEKGKHDDGRKKEAEIIKQLK    561 - 630
IELKKAQESQKEMKLLLDMYRSAPKEQRDKVQLMAAEKKSKAELEDLRQRLKDLEDKEKKENKKMADEDA    631 - 700
LRKIRAVEEQIEYLQKKLAMAKQEEEALLSEMDVTGQAFEDMQEQNIRLMQQLREKDDANFKLMSERIKS    701 - 770
NQIHKLLKEEKEELADQVLTLKTQVDAQLQVVRKLEEKEHLLQSNIGTGEKELGLRTQALEMNKRKAMEA    771 - 840
AQLADDLKAQLELAQKKLHDFQDEIVENSVTKEKDMFNFKRAQEDISRLRRKLETTKKPDNVPKCDEILM    841 - 910
EEIKDYKARLTCPCCNMRKKDAVLTKCFHVFCFECVKTRYDTRQRKCPKCNAAFGANDFHRIYIG         911 - 975
//

Text Mined References (52)

PMID Year Title
26206755 2015 RE-IIBP Methylates H3K79 and Induces MEIS1-mediated Apoptosis via H2BK120 Ubiquitination by RNF20.
25640309 2015 Systematic identification of molecular links between core and candidate genes in breast cancer.
25416956 2014 A proteome-scale map of the human interactome network.
24600005 2014 Adenovirus E1A recruits the human Paf1 complex to enhance transcriptional elongation.
24357716 2014 Histone chaperone FACT regulates homologous recombination by chromatin remodeling through interaction with RNF20.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23785282 2013 Viral retasking of hBre1/RNF20 to recruit hPaf1 for transcriptional activation.
23412334 2013 Histone H2B ubiquitin ligase RNF20 is required for MLL-rearranged leukemia.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...