Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.68
PubTator Score 0.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.300 3.2e-02
astrocytic glioma -1.500 3.2e-03
atypical teratoid / rhabdoid tumor -2.800 4.8e-09
ependymoma -1.800 1.7e-03
glioblastoma -1.100 7.7e-03
group 4 medulloblastoma -1.600 1.2e-02
medulloblastoma, large-cell 1.300 4.3e-06
oligodendroglioma -1.500 2.4e-03
primitive neuroectodermal tumor -1.900 6.1e-03

Gene RIF (2)

AA Sequence

MGCIQSITCKARIRRENIVVYDVCATIDQCPTRIEETSPIVLRYKTPYFKASARVVMPPIPRHETWVVGW      1 - 70
IQACNQMEFFNTYSDLGMSSWELPDLREGRVKAISDSDGVSYPWYGNTTETVTLVGPTNKISRFSVSMND     71 - 140
NFYPSVTWAVPVSDSNVPLLTRIKRDQSFTTWLVAMNTTTKEKIILQTIKWRMRVDIEVDPLQLLGQRAR    141 - 210
LVGRTQQEQPRILSRMEPIPPNALVKPNANDAQVLMWRPKRGPPLVVIPPK                       211 - 261
//

Text Mined References (8)

PMID Year Title