Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.68
PubTator Score 0.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.500 0.003
posterior fossa group A ependymoma -2.500 0.000
oligodendroglioma -1.500 0.002
glioblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -2.800 0.000
medulloblastoma -1.900 0.002
medulloblastoma, large-cell 1.300 0.000
primitive neuroectodermal tumor -1.900 0.006
pediatric high grade glioma -1.300 0.003

Synonym

Accession Q5VT40 B7Z693
Symbols

Gene

 Compartment GO Term (1)

Gene RIF (2)

PMID Text
19536175 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGCIQSITCKARIRRENIVVYDVCATIDQCPTRIEETSPIVLRYKTPYFKASARVVMPPIPRHETWVVGW      1 - 70
IQACNQMEFFNTYSDLGMSSWELPDLREGRVKAISDSDGVSYPWYGNTTETVTLVGPTNKISRFSVSMND     71 - 140
NFYPSVTWAVPVSDSNVPLLTRIKRDQSFTTWLVAMNTTTKEKIILQTIKWRMRVDIEVDPLQLLGQRAR    141 - 210
LVGRTQQEQPRILSRMEPIPPNALVKPNANDAQVLMWRPKRGPPLVVIPPK                       211 - 261
//

Text Mined References (8)

PMID Year Title
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.